| IED ID | IndEnz0002007236 |
| Enzyme Type ID | protease007236 |
| Protein Name |
Serine protease inhibitor Kazal-type 4 Peptide PEC-60 |
| Gene Name | SPINK4 |
| Organism | Sus scrofa (Pig) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Laurasiatheria Artiodactyla Suina Suidae (pigs) Sus Sus scrofa (Pig) |
| Enzyme Sequence | MAVRLWVVALALAALFIVDREVPVSAEKQVFSRMPICEHMTESPDCSRIYDPVCGTDGVTYESECKLCLARIENKQDIQIVKDGEC |
| Enzyme Length | 86 |
| Uniprot Accession Number | P37109 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Inhibits the glucose-induced insulin secretion from perfused pancreas; also plays a role in the immune system. Does not inhibit trypsin. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Beta strand (4); Chain (1); Disulfide bond (3); Domain (1); Helix (1); Signal peptide (1); Site (1) |
| Keywords | 3D-structure;Direct protein sequencing;Disulfide bond;Reference proteome;Secreted;Signal |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..26; /evidence=ECO:0000269|PubMed:2573065 |
| Structure 3D | NMR spectroscopy (1) |
| Cross Reference PDB | 1PCE; |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 9,635 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |