| IED ID | IndEnz0002007238 |
| Enzyme Type ID | protease007238 |
| Protein Name |
Trypsin inhibitor ClTI EC 3.4.21.4 Fragment |
| Gene Name | |
| Organism | Cassia leiandra (Marimari) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae rosids fabids Fabales Fabaceae Caesalpinioideae Cassia clade Cassia Cassia leiandra (Marimari) |
| Enzyme Sequence | SVELDSDGEPIRNGGGLYYILPVVQGKGGGLEFAKTGSQS |
| Enzyme Length | 40 |
| Uniprot Accession Number | C0HK48 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=Preferential cleavage: Arg-|-Xaa, Lys-|-Xaa.; EC=3.4.21.4; Evidence={ECO:0000269|Ref.1}; |
| DNA Binding | |
| EC Number | 3.4.21.4 |
| Enzyme Function | FUNCTION: Inhibits trypsin but not chymotrypsin, papain or porcine pancreatic alpha-amylase. Has insecticidal activity against A.aegypti. Functions by inhibiting the A.aegypti midgut proteases to reduce the survival of larva and adults. {ECO:0000269|Ref.1}. |
| Temperature Dependency | BIOPHYSICOCHEMICAL PROPERTIES: Temperature dependence: Stable at temperatures up to 70 degrees Celsius. Incubation at temperatures above 70 degrees Celsius steadily decreases inhibitory activity. {ECO:0000269|Ref.1}; |
| PH Dependency | BIOPHYSICOCHEMICAL PROPERTIES: pH dependence: Stable in the pH range 2.2-10.0. {ECO:0000269|Ref.1}; |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Non-terminal residue (1) |
| Keywords | Direct protein sequencing;Hydrolase;Protease inhibitor;Serine protease inhibitor |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 4,097 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |