| IED ID | IndEnz0002007243 |
| Enzyme Type ID | protease007243 |
| Protein Name |
Serine protease inhibitor Kazal-type 6 Acrosin inhibitor 2 Acrosin inhibitor IIA BUSI-II |
| Gene Name | SPINK6 |
| Organism | Bos taurus (Bovine) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Laurasiatheria Artiodactyla Ruminantia Pecora Bovidae Bovinae Bos (oxen cattle) Bos taurus (Bovine) |
| Enzyme Sequence | MKTSGVFLLLSLALFCFFSGVFGQGAQVDCAEFKDPKVYCTRESNPHCGSDGQTYGNKCAFCKAVMKSGGKINLKHRGKC |
| Enzyme Length | 80 |
| Uniprot Accession Number | P01001 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Serine protease inhibitor selective for kallikreins. Efficiently inhibits KLK4, KLK5, KLK6, KLK7, KLK12, KLK13 and KLK14. Doesn't inhibit KLK8. Inhibits acrosin, trypsin, and chymotrypsin. {ECO:0000250|UniProtKB:Q6UWN8}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Beta strand (5); Chain (1); Disulfide bond (3); Domain (1); Helix (2); Modified residue (1); Natural variant (1); Sequence conflict (1); Signal peptide (1); Site (1); Turn (1) |
| Keywords | 3D-structure;Direct protein sequencing;Disulfide bond;Protease inhibitor;Pyrrolidone carboxylic acid;Reference proteome;Secreted;Serine protease inhibitor;Signal |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000250|UniProtKB:Q8BT20}. |
| Modified Residue | MOD_RES 24; /note=Pyrrolidone carboxylic acid; /evidence=ECO:0000269|PubMed:500016 |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..23; /evidence=ECO:0000269|PubMed:500016 |
| Structure 3D | NMR spectroscopy (2) |
| Cross Reference PDB | 1BUS; 2BUS; |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 8,663 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |