| IED ID | IndEnz0002007250 |
| Enzyme Type ID | protease007250 |
| Protein Name |
Probable murein peptide carboxypeptidase EC 3.4.16.- LD-carboxypeptidase |
| Gene Name | ykfA BSU12970 |
| Organism | Bacillus subtilis (strain 168) |
| Taxonomic Lineage | cellular organisms Bacteria Terrabacteria group Firmicutes Bacilli Bacillales Bacillaceae Bacillus Bacillus subtilis group Bacillus subtilis Bacillus subtilis subsp. subtilis Bacillus subtilis (strain 168) |
| Enzyme Sequence | MKGVFSLNYKPKALNKGDTVGVIAPASPPDPKKLDTALLFLEELGLQVKLGKALKNQHGYLAGQDDERLADLHEMFRDDEVKAVLCACGGFGTGRIAAGIDFSLIRKHPKIFWGYSDITFLHTAIHQNTGLVTFHGPMLSTDIGLDDVHPLTKASYKQLFQETEFTYTEELSPLTELVPGKAEGELVGGNLSLLTSTLGTPFEIDTRGKLLFIEDIDEEPYQIDRMLNQLKMGGKLTDAAGILVCDFHNCVPVKREKSLSLEQVLEDYIISAGRPALRGFKIGHCSPSIAVPIGAKAAMNTAEKTAVIEAGVSEGALKT |
| Enzyme Length | 319 |
| Uniprot Accession Number | O34851 |
| Absorption | |
| Active Site | ACT_SITE 116; /note=Nucleophile; /evidence=ECO:0000250; ACT_SITE 214; /note=Charge relay system; /evidence=ECO:0000250; ACT_SITE 284; /note=Charge relay system; /evidence=ECO:0000250 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.4.16.- |
| Enzyme Function | FUNCTION: May be involved in the degradation of peptidoglycan by catalyzing the cleavage of the terminal D-alanine residue from cytoplasmic murein peptides. {ECO:0000250}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | PATHWAY: Cell wall degradation; peptidoglycan degradation. |
| nucleotide Binding | |
| Features | Active site (3); Chain (1); Frameshift (1) |
| Keywords | Carboxypeptidase;Cell wall biogenesis/degradation;Cytoplasm;Hydrolase;Protease;Reference proteome;Serine protease |
| Interact With | |
| Induction | INDUCTION: Repressed by AbrB, a transcription factor that negatively controls biofilm formation. {ECO:0000269|PubMed:15101989}. |
| Subcellular Location | SUBCELLULAR LOCATION: Cytoplasm {ECO:0000250}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 34,596 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |