| IED ID | IndEnz0002007282 |
| Enzyme Type ID | protease007282 |
| Protein Name |
Early 35 kDa protein Apoptosis-preventing protein p35 |
| Gene Name | P35 |
| Organism | Autographa californica nuclear polyhedrosis virus (AcMNPV) |
| Taxonomic Lineage | Viruses Naldaviricetes Lefavirales Baculoviridae Alphabaculovirus Autographa californica multiple nucleopolyhedrovirus Autographa californica nuclear polyhedrosis virus (AcMNPV) |
| Enzyme Sequence | MCVIFPVEIDVSQTIIRDCQVDKQTRELVYINKIMNTQLTKPVLMMFNISGPIRSVTRKNNNLRDRIKSKVDEQFDQLERDYSDQMDGFHDSIKYFKDEHYSVSCQNGSVLKSKFAKILKSHDYTDKKSIEAYEKYCLPKLVDERNDYYVAVCVLKPGFENGSNQVLSFEYNPIGNKVIVPFAHEINDTGLYEYDVVAYVDSVQFDGEQFEEFVQSLILPSSFKNSEKVLYYNEASKNKSMIYKALEFTTESSWGKSEKYNWKIFCNGFIYDKKSKVLYVKLHNVTSALNKNVILNTIK |
| Enzyme Length | 299 |
| Uniprot Accession Number | P08160 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Functions as an inhibitor of the host RNA interference antiviral response. Inhibits the insect host cell apoptotic response initiated by the viral infection. Blocks as well the activity of members of the caspase family of proteases. Required for late and very late gene expression. {ECO:0000269|PubMed:16081248, ECO:0000269|PubMed:1962198, ECO:0000269|PubMed:26018163}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Beta strand (21); Chain (1); Helix (7); Turn (2) |
| Keywords | 3D-structure;Apoptosis;Early protein;Host-virus interaction;Inhibition of host caspases by virus;Modulation of host cell apoptosis by virus;Protease inhibitor;Reference proteome;Suppressor of RNA silencing;Thiol protease inhibitor |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | X-ray crystallography (5) |
| Cross Reference PDB | 1I3P; 1I3S; 1I4E; 1P35; 2FUN; |
| Mapped Pubmed ID | 10205157; 11260720; 11402050; 16492559; |
| Motif | |
| Gene Encoded By | |
| Mass | 34,829 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |