| IED ID |
IndEnz0002007330 |
| Enzyme Type ID |
protease007330 |
| Protein Name |
Magnetosome protein MamC
|
| Gene Name |
mamC mms13 amb0951 |
| Organism |
Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) |
| Taxonomic Lineage |
cellular organisms
Bacteria
Proteobacteria
Alphaproteobacteria
Rhodospirillales
Rhodospirillaceae (purple nonsulfur bacteria)
Magnetospirillum
Magnetospirillum magneticum
Magnetospirillum magneticum (strain AMB-1 / ATCC 700264)
|
| Enzyme Sequence |
MPFHLAPYLAKSVPGVGVLGALVGGAAALAKNVRLLKEKRITNTEAAIDTGKETVGAGLATALSAVAATAVGGGLVVSLGTALVAGVAAKYAWDRGVDLVEKELNRGKAANGASDEDILRDELA |
| Enzyme Length |
124 |
| Uniprot Accession Number |
Q2W8S0 |
| Absorption |
|
| Active Site |
|
| Activity Regulation |
|
| Binding Site |
|
| Calcium Binding |
|
| catalytic Activity |
|
| DNA Binding |
|
| EC Number |
|
| Enzyme Function |
FUNCTION: Probably involved in magnetite crystal growth (Probable). The lumenal domain may bind the magnetite crystals, affecting crystal size and shape (Probable). {ECO:0000305|PubMed:24961165, ECO:0000305|PubMed:26970040, ECO:0000305|PubMed:30405554}. |
| Temperature Dependency |
|
| PH Dependency |
|
| Pathway |
|
| nucleotide Binding |
|
| Features |
Beta strand (2); Chain (1); Erroneous initiation (1); Initiator methionine (1); Mutagenesis (3); Region (1); Topological domain (3); Transmembrane (2) |
| Keywords |
3D-structure;Biomineralization;Direct protein sequencing;Iron;Magnetosome;Membrane;Metal-binding;Reference proteome;Transmembrane;Transmembrane helix |
| Interact With |
|
| Induction |
|
| Subcellular Location |
SUBCELLULAR LOCATION: Magnetosome membrane {ECO:0000269|PubMed:12496282, ECO:0000269|PubMed:16303747, ECO:0000269|PubMed:21414040, ECO:0000269|PubMed:27481925, ECO:0000269|PubMed:28790202, ECO:0000305|PubMed:22846572}; Multi-pass membrane protein {ECO:0000255}. Note=Tightly associated with magnetite crystals (PubMed:12496282). Tagged protein forms straight lines with a punctate pattern extending along most of the cell associated with its inner curvature, in the correct position to be associated with magnetite-containing magnetosomes (PubMed:21414040, PubMed:27481925, PubMed:28790202). In a mamE disruption MamC forms 1-2 foci in the cell (PubMed:21414040). {ECO:0000269|PubMed:12496282, ECO:0000269|PubMed:21414040, ECO:0000269|PubMed:27481925, ECO:0000269|PubMed:28790202}. |
| Modified Residue |
|
| Post Translational Modification |
|
| Signal Peptide |
|
| Structure 3D |
X-ray crystallography (4) |
| Cross Reference PDB |
5E7U;
5I69;
5MM3;
6EQZ;
|
| Mapped Pubmed ID |
- |
| Motif |
|
| Gene Encoded By |
|
| Mass |
12,378 |
| Kinetics |
|
| Metal Binding |
|
| Rhea ID |
|
| Cross Reference Brenda |
|