| IED ID |
IndEnz0002007331 |
| Enzyme Type ID |
protease007331 |
| Protein Name |
Magnetosome protein MamI
|
| Gene Name |
mamI amb0962 |
| Organism |
Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) |
| Taxonomic Lineage |
cellular organisms
Bacteria
Proteobacteria
Alphaproteobacteria
Rhodospirillales
Rhodospirillaceae (purple nonsulfur bacteria)
Magnetospirillum
Magnetospirillum magneticum
Magnetospirillum magneticum (strain AMB-1 / ATCC 700264)
|
| Enzyme Sequence |
MPSVIFGLLALALGLLGVTAWWWSVTEFLRGAVPVALLILGLVALASGVQSVRLPRSNKGTASDPDIDG |
| Enzyme Length |
69 |
| Uniprot Accession Number |
Q2W8Q9 |
| Absorption |
|
| Active Site |
|
| Activity Regulation |
|
| Binding Site |
|
| Calcium Binding |
|
| catalytic Activity |
|
| DNA Binding |
|
| EC Number |
|
| Enzyme Function |
FUNCTION: Essential for magnetosome formation (PubMed:20212111). May bind magnetite (Probable). May be involved in an early stage of magnetosome nucleation (By similarity). {ECO:0000250|UniProtKB:Q6NE62, ECO:0000269|PubMed:20212111, ECO:0000305|PubMed:27528487}. |
| Temperature Dependency |
|
| PH Dependency |
|
| Pathway |
|
| nucleotide Binding |
|
| Features |
Chain (1); Topological domain (3); Transmembrane (2) |
| Keywords |
Biomineralization;Iron;Magnetosome;Membrane;Metal-binding;Reference proteome;Transmembrane;Transmembrane helix |
| Interact With |
|
| Induction |
INDUCTION: Part of the probable 18 gene mamAB operon. {ECO:0000305|PubMed:20212111}. |
| Subcellular Location |
SUBCELLULAR LOCATION: Magnetosome membrane {ECO:0000269|PubMed:28790202, ECO:0000305|PubMed:20212111}; Multi-pass membrane protein {ECO:0000255}. Note=Tagged protein forms straight lines extending along most of the cell associated with its inner curvature, in the correct position to be associated with magnetosomes (PubMed:20212111, PubMed:21414040, PubMed:21883528, PubMed:28790202). In a mamK deletion MamI forms a linear punctate pattern, suggesting it is associated with magnetosomes (PubMed:20212111). In a mamE deletion MamI forms a linear punctate pattern (PubMed:21414040). In double mamJ/limJ deletion MamI forms a linear punctate pattern (PubMed:21883528). {ECO:0000269|PubMed:20212111, ECO:0000269|PubMed:21414040, ECO:0000269|PubMed:21883528, ECO:0000269|PubMed:28790202}. |
| Modified Residue |
|
| Post Translational Modification |
|
| Signal Peptide |
|
| Structure 3D |
|
| Cross Reference PDB |
- |
| Mapped Pubmed ID |
- |
| Motif |
|
| Gene Encoded By |
|
| Mass |
7,158 |
| Kinetics |
|
| Metal Binding |
|
| Rhea ID |
|
| Cross Reference Brenda |
|