| IED ID | IndEnz0002007380 |
| Enzyme Type ID | protease007380 |
| Protein Name |
Prostasin EC 3.4.21.- Channel-activating protease 1 CAP1 Serine protease 8 Cleaved into: Prostasin light chain; Prostasin heavy chain |
| Gene Name | Prss8 |
| Organism | Rattus norvegicus (Rat) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Glires (Rodents and rabbits) Rodentia Myomorpha (mice and others) Muroidea Muridae Murinae Rattus Rattus norvegicus (Rat) |
| Enzyme Sequence | MALRVGLGLGQLEALFVLLLIGLLQSRIGADGTEASCGAVIQPRITGGGSAKPGQWPWQVSITYNGVHVCGGSLVSNQWVVSAAHCFPREHSKEEYEVKLGAHQLDSFSNDIVVHTVAQIISHSSYREEGSQGDIALIRLSSPVTFSRYIRPICLPAANASFPNGLHCTVTGWGHVAPSVSLQTPRPLQQLEVPLISRETCSCLYNINAVPEEPHTIQQDMLCAGYVKGGKDACQGDSGGPLSCPIDGLWYLAGIVSWGDACGAPNRPGVYTLTSTYASWIHHHVAELQPRVVPQTQESQPDGHLCNHHPVFNLAAAQKLSRPILFLPLSLTLGLFSLWLEH |
| Enzyme Length | 342 |
| Uniprot Accession Number | Q9ES87 |
| Absorption | |
| Active Site | ACT_SITE 85; /note=Charge relay system; /evidence=ECO:0000250; ACT_SITE 134; /note=Charge relay system; /evidence=ECO:0000250; ACT_SITE 238; /note=Charge relay system; /evidence=ECO:0000250 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.4.21.- |
| Enzyme Function | FUNCTION: Possesses a trypsin-like cleavage specificity with a preference for poly-basic substrates. Stimulates epithelial sodium channel (ENaC) activity through activating cleavage of the gamma subunits (SCNN1G) (By similarity). {ECO:0000250}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (3); Chain (3); Disulfide bond (5); Domain (1); Glycosylation (1); Propeptide (2); Sequence conflict (2); Signal peptide (1); Transmembrane (1) |
| Keywords | Cell membrane;Disulfide bond;Glycoprotein;Hydrolase;Membrane;Protease;Reference proteome;Secreted;Serine protease;Signal;Transmembrane;Transmembrane helix;Zymogen |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Cell membrane {ECO:0000250}; Single-pass membrane protein {ECO:0000250}.; SUBCELLULAR LOCATION: [Prostasin]: Secreted, extracellular space {ECO:0000250}.; SUBCELLULAR LOCATION: [Prostasin light chain]: Secreted, extracellular space {ECO:0000250}. Note=Found in the seminal fluid. Secreted after cleavage of its C-terminus. {ECO:0000250}.; SUBCELLULAR LOCATION: [Prostasin heavy chain]: Secreted, extracellular space {ECO:0000250}. Note=Found in the seminal fluid. Secreted after cleavage of its C-terminus. {ECO:0000250}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..29; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 12506133; 16528252; 17468916; 20201958; |
| Motif | |
| Gene Encoded By | |
| Mass | 36,857 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |