| IED ID | IndEnz0002007384 |
| Enzyme Type ID | protease007384 |
| Protein Name |
Host protease inhibitor Protein pin |
| Gene Name | pin pinA |
| Organism | Enterobacteria phage T4 (Bacteriophage T4) |
| Taxonomic Lineage | Viruses Duplodnaviria Heunggongvirae Uroviricota Caudoviricetes Caudovirales Myoviridae (phages with contractile tails) Tevenvirinae Tequatrovirus Enterobacteria phage T4 (Bacteriophage T4) |
| Enzyme Sequence | MITVDKWFRINRADTGLCNYWPELSAGTVFKVRELVKECEDDIEPDTGIIEIELSDGKIINIYDKPITYWCLWNTESVENGEIEEVVERTNQVVQKPKADFQGERISYALAKLAAQENNDGYEGNLMQAAAEYIEWLETQISFSDRMIQQYKRLHQMFYNT |
| Enzyme Length | 161 |
| Uniprot Accession Number | P07068 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Plays a role in the inhibition of bacterial toxin-antitoxin system by blocking the action of host Lon protease. {ECO:0000269|PubMed:2838455}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1) |
| Keywords | Protease inhibitor;Reference proteome |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 18,816 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |