Detail Information for IndEnz0002007396
IED ID IndEnz0002007396
Enzyme Type ID protease007396
Protein Name Proteasome subunit alpha
20S proteasome alpha subunit
Proteasome core protein PsmA
Gene Name psmA M164_1397
Organism Sulfolobus islandicus (strain M.16.4 / Kamchatka #3)
Taxonomic Lineage cellular organisms Archaea TACK group Crenarchaeota Thermoprotei Sulfolobales Sulfolobaceae Sulfolobus Sulfolobus islandicus Sulfolobus islandicus (strain M.16.4 / Kamchatka #3)
Enzyme Sequence MAFGPAAMGYDRAITIFSPDGSLYQVDYAFEAVKKGWTAIGIKSKSGVVIASEKRKAQSLLDVDSIEKVFLIDDHVGCSFAGLASDGRVLIDYARNIALQHRLIYDEPVSIDYLTKSVADVKQMYTQHGGVRPFGVALVIAGIDKSVPKLYMTEPSGQYMPYQAVAIGQGYYTATEFLEKNYKEDLTIEDTILLALKALSATLKPNEKLTPNTVEIGYASTQTGLFLKMTSEDKNMYLQKL
Enzyme Length 241
Uniprot Accession Number C4KHD9
Absorption
Active Site
Activity Regulation ACTIVITY REGULATION: The formation of the proteasomal ATPase PAN-20S proteasome complex, via the docking of the C-termini of PAN into the intersubunit pockets in the alpha-rings, triggers opening of the gate for substrate entry. Interconversion between the open-gate and close-gate conformations leads to a dynamic regulation of the 20S proteasome proteolysis activity. {ECO:0000255|HAMAP-Rule:MF_00289}.
Binding Site
Calcium Binding
catalytic Activity
DNA Binding
EC Number
Enzyme Function FUNCTION: Component of the proteasome core, a large protease complex with broad specificity involved in protein degradation. {ECO:0000255|HAMAP-Rule:MF_00289}.
Temperature Dependency
PH Dependency
Pathway
nucleotide Binding
Features Chain (1)
Keywords Cytoplasm;Proteasome
Interact With
Induction
Subcellular Location SUBCELLULAR LOCATION: Cytoplasm {ECO:0000255|HAMAP-Rule:MF_00289}.
Modified Residue
Post Translational Modification
Signal Peptide
Structure 3D
Cross Reference PDB -
Mapped Pubmed ID -
Motif
Gene Encoded By
Mass 26,535
Kinetics
Metal Binding
Rhea ID
Cross Reference Brenda