IED ID | IndEnz0002007397 |
Enzyme Type ID | protease007397 |
Protein Name |
Proteasome subunit beta type-6 EC 3.4.25.1 Differentiation-associated proteasome subunit 1 DAPS-1 |
Gene Name | psmB6 dapA DDB_G0267390 |
Organism | Dictyostelium discoideum (Slime mold) |
Taxonomic Lineage | cellular organisms Eukaryota Amoebozoa Evosea Eumycetozoa Dictyostelia (dictyostelid cellular slime molds) Dictyosteliales Dictyosteliaceae Dictyostelium Dictyostelium discoideum (Slime mold) |
Enzyme Sequence | MEAPEWLDNAVDLGTSIMAVEYDGGVIMGADSRTTTGAYIANRVTNKITPIHERIYCCRSGSAADTQAISDYVRYYLEMHTSELCDEPDVKTAASLFQLLCYSNKNNLMAGIIVAGWDKHQGGSVYNISLGGSMVKQPFAIGGSGSTYIYGYCDSKFKPKMTKDECIEFVQNSLALAMFRDGSSGGVIRLCIIDKNGVERKMIPGNNLPRFWEG |
Enzyme Length | 214 |
Uniprot Accession Number | Q55GJ6 |
Absorption | |
Active Site | ACT_SITE 15; /note=Nucleophile; /evidence=ECO:0000250 |
Activity Regulation | |
Binding Site | |
Calcium Binding | |
catalytic Activity | CATALYTIC ACTIVITY: Reaction=Cleavage of peptide bonds with very broad specificity.; EC=3.4.25.1; |
DNA Binding | |
EC Number | 3.4.25.1 |
Enzyme Function | FUNCTION: The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity. {ECO:0000269|PubMed:8130037}. |
Temperature Dependency | |
PH Dependency | |
Pathway | |
nucleotide Binding | |
Features | Active site (1); Chain (1); Propeptide (1); Sequence conflict (5) |
Keywords | Cytoplasm;Direct protein sequencing;Hydrolase;Nucleus;Protease;Proteasome;Reference proteome;Threonine protease;Zymogen |
Interact With | |
Induction | |
Subcellular Location | SUBCELLULAR LOCATION: Cytoplasm {ECO:0000255|PROSITE-ProRule:PRU00809, ECO:0000269|PubMed:8130037}. Nucleus {ECO:0000269|PubMed:8130037}. |
Modified Residue | |
Post Translational Modification | |
Signal Peptide | |
Structure 3D | |
Cross Reference PDB | - |
Mapped Pubmed ID | - |
Motif | |
Gene Encoded By | |
Mass | 23,446 |
Kinetics | |
Metal Binding | |
Rhea ID | |
Cross Reference Brenda |