| IED ID | IndEnz0002007400 |
| Enzyme Type ID | protease007400 |
| Protein Name |
Probable proteasome subunit beta type-1 EC 3.4.25.1 26S proteasome beta-type subunit PRE3 Multicatalytic endopeptidase complex subunit PRE3 |
| Gene Name | PRE3 ECU10_1450 |
| Organism | Encephalitozoon cuniculi (strain GB-M1) (Microsporidian parasite) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Fungi Fungi incertae sedis Microsporidia Apansporoblastina Unikaryonidae Encephalitozoon Encephalitozoon cuniculi (Microsporidian parasite) Encephalitozoon cuniculi (strain GB-M1) (Microsporidian parasite) |
| Enzyme Sequence | MMSNEKEMTGTTIIAIKYDDGVLIGADSRTSMGAYVSSRVTDKLTQITDKIFVCRSGSSADTQMISSYLRMYLSMYSQLEDSIPQVQRAAALASKIIYENPSLLAGLIVAGYDDKPRVFNISLGGSLTERDWAIGGSGSAFIYGYCDVNWRSGMSLEEGIRFVRNAVSCAINRDNASGGCIRMSAISRTGVQRYFYPGDKVLQ |
| Enzyme Length | 203 |
| Uniprot Accession Number | Q8SR11 |
| Absorption | |
| Active Site | ACT_SITE 11; /note=Nucleophile; /evidence=ECO:0000250 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=Cleavage of peptide bonds with very broad specificity.; EC=3.4.25.1; |
| DNA Binding | |
| EC Number | 3.4.25.1 |
| Enzyme Function | FUNCTION: The proteasome degrades poly-ubiquitinated proteins in the cytoplasm and in the nucleus. It is essential for the regulated turnover of proteins and for the removal of misfolded proteins. The proteasome is a multicatalytic proteinase complex that is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. It has an ATP-dependent proteolytic activity (By similarity). {ECO:0000250}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (1); Chain (1); Propeptide (1) |
| Keywords | Cytoplasm;Hydrolase;Nucleus;Protease;Proteasome;Reference proteome;Threonine protease |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Cytoplasm {ECO:0000255|PROSITE-ProRule:PRU00809}. Nucleus {ECO:0000250}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 22,189 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |