| IED ID | IndEnz0002007416 |
| Enzyme Type ID | protease007416 |
| Protein Name |
Type 4 prepilin-like proteins leader peptide-processing enzyme EC 2.1.1.- EC 3.4.23.43 |
| Gene Name | pppA ETEC_3240 |
| Organism | Escherichia coli O78:H11 (strain H10407 / ETEC) |
| Taxonomic Lineage | cellular organisms Bacteria Proteobacteria Gammaproteobacteria Enterobacterales Enterobacteriaceae Escherichia Escherichia coli Escherichia coli O78:H11 (strain H10407 / ETEC) |
| Enzyme Sequence | MLFDVFQQYPAAMPVLATVGGLIIGSFLNVVIWRYPIMLRQQMAEFHGEMPSVQSKISLALPRSHCPHCQQTIRIRDNIPLLSWLMLKGRCRDCQAKISKRYPLVELLTALAFLLASLVWPESGWALAVMILSAWLIAASVIDLDHQWLPDVFTQGVLWTGLIAAWAQQSPLTLQDAVTGVLVGFIAFYSLRWIAGIVLRKEALGMGDVLLFAALGSWVGPLSLPNVALIASCCGLIYAVITKRGTTTLPFGPCLSLGGIATIYLQALF |
| Enzyme Length | 269 |
| Uniprot Accession Number | E3PJ89 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=Typically cleaves a -Gly-|-Phe- bond to release an N-terminal, basic peptide of 5-8 residues from type IV prepilin, and then N-methylates the new N-terminal amino group, the methyl donor being S-adenosyl-L-methionine.; EC=3.4.23.43; Evidence={ECO:0000255|RuleBase:RU003794}; |
| DNA Binding | |
| EC Number | 2.1.1.-; 3.4.23.43 |
| Enzyme Function | FUNCTION: Cleaves type-4 fimbrial leader sequence and methylates the N-terminal (generally Phe) residue. {ECO:0000255|RuleBase:RU003794}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Transmembrane (7) |
| Keywords | Cell inner membrane;Cell membrane;Hydrolase;Membrane;Methyltransferase;Multifunctional enzyme;Protease;Transferase;Transmembrane;Transmembrane helix |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Cell inner membrane {ECO:0000255}; Multi-pass membrane protein {ECO:0000255}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 29,494 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |