Detail Information for IndEnz0002007446
IED ID IndEnz0002007446
Enzyme Type ID protease007446
Protein Name Cellular tumor antigen p53
Tumor suppressor p53
Gene Name TP53 P53
Organism Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Taxonomic Lineage cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Primates Haplorrhini Simiiformes Catarrhini Cercopithecoidea Cercopithecidae (Old World monkeys) Cercopithecinae Macaca (macaques) Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Enzyme Sequence MEEPQSDPSIEPPLSQETFSDLWKLLPENNVLSPLPSQAVDDLMLSPDDLAQWLTEDPGPDEAPRMSEAAPPMAPTPAAPTPAAPAPAPSWPLSSSVPSQKTYHGSYGFRLGFLHSGTAKSVTCTYSPDLNKMFCQLAKTCPVQLWVDSTPPPGSRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRVEYSDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENFRKKGEPCHQLPPGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPAGSRAHSSHLKSKKGQSTSRHKKFMFKTEGPDSD
Enzyme Length 393
Uniprot Accession Number P56423
Absorption
Active Site
Activity Regulation
Binding Site
Calcium Binding
catalytic Activity
DNA Binding DNA_BIND 102..292; /evidence=ECO:0000250
EC Number
Enzyme Function FUNCTION: Acts as a tumor suppressor in many tumor types; induces growth arrest or apoptosis depending on the physiological circumstances and cell type. Involved in cell cycle regulation as a trans-activator that acts to negatively regulate cell division by controlling a set of genes required for this process. One of the activated genes is an inhibitor of cyclin-dependent kinases. Apoptosis induction seems to be mediated either by stimulation of BAX and FAS antigen expression, or by repression of Bcl-2 expression. Its pro-apoptotic activity is activated via its interaction with PPP1R13B/ASPP1 or TP53BP2/ASPP2 (By similarity). However, this activity is inhibited when the interaction with PPP1R13B/ASPP1 or TP53BP2/ASPP2 is displaced by PPP1R13L/iASPP (By similarity). In cooperation with mitochondrial PPIF is involved in activating oxidative stress-induced necrosis; the function is largely independent of transcription. Prevents CDK7 kinase activity when associated to CAK complex in response to DNA damage, thus stopping cell cycle progression. Induces the transcription of long intergenic non-coding RNA p21 (lincRNA-p21) and lincRNA-Mkln1. LincRNA-p21 participates in TP53-dependent transcriptional repression leading to apoptosis and seems to have an effect on cell-cycle regulation. Regulates the circadian clock by repressing CLOCK-ARNTL/BMAL1-mediated transcriptional activation of PER2. {ECO:0000250|UniProtKB:P02340, ECO:0000250|UniProtKB:P04637}.
Temperature Dependency
PH Dependency
Pathway
nucleotide Binding
Features Chain (1); Compositional bias (3); Cross-link (4); DNA binding (1); Metal binding (4); Modified residue (29); Motif (3); Region (18); Sequence conflict (1); Site (1)
Keywords Acetylation;Activator;Apoptosis;Biological rhythms;Cell cycle;Cytoplasm;Cytoskeleton;DNA-binding;Endoplasmic reticulum;Isopeptide bond;Metal-binding;Methylation;Mitochondrion;Necrosis;Nucleus;Phosphoprotein;Reference proteome;Repressor;Transcription;Transcription regulation;Tumor suppressor;Ubl conjugation;Zinc
Interact With
Induction
Subcellular Location SUBCELLULAR LOCATION: Cytoplasm {ECO:0000250|UniProtKB:P04637}. Nucleus {ECO:0000250|UniProtKB:P04637}. Nucleus, PML body {ECO:0000250|UniProtKB:P04637}. Endoplasmic reticulum {ECO:0000250|UniProtKB:P04637}. Mitochondrion matrix {ECO:0000250|UniProtKB:P04637}. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome {ECO:0000250|UniProtKB:P04637}. Note=Interaction with BANP promotes nuclear localization. Recruited into PML bodies together with CHEK2. Translocates to mitochondria upon oxidative stress. Translocates to mitochondria in response to mitomycin C treatment (By similarity). {ECO:0000250|UniProtKB:P04637}.
Modified Residue MOD_RES 9; /note="Phosphoserine; by HIPK4"; /evidence="ECO:0000250|UniProtKB:P04637"; MOD_RES 15; /note="Phosphoserine; by CDK5, PRPK, AMPK, NUAK1 and ATM"; /evidence="ECO:0000250|UniProtKB:P04637"; MOD_RES 18; /note="Phosphothreonine; by CK1, VRK1 and VRK2"; /evidence="ECO:0000250|UniProtKB:P04637"; MOD_RES 20; /note="Phosphoserine; by CHEK2, CK1 and PLK3"; /evidence="ECO:0000250|UniProtKB:P04637"; MOD_RES 33; /note="Phosphoserine; by CDK5 and CDK7"; /evidence="ECO:0000250|UniProtKB:P04637"; MOD_RES 37; /note="Phosphoserine; by MAPKAPK5"; /evidence="ECO:0000250|UniProtKB:P04637"; MOD_RES 46; /note="Phosphoserine; by CDK5, DYRK2, HIPK2 and PKC/PRKCG"; /evidence="ECO:0000250|UniProtKB:P04637"; MOD_RES 55; /note="Phosphothreonine; by TAF1"; /evidence="ECO:0000250"; MOD_RES 55; /note="Phosphothreonine; by TAF1 and GRK5"; /evidence="ECO:0000250"; MOD_RES 120; /note="N6-acetyllysine; by KAT6A"; /evidence="ECO:0000250|UniProtKB:P04637"; MOD_RES 183; /note="Phosphoserine; by AURKB"; /evidence="ECO:0000250|UniProtKB:P04637"; MOD_RES 269; /note="Phosphoserine; by AURKB"; /evidence="ECO:0000250|UniProtKB:P04637"; MOD_RES 284; /note="Phosphothreonine; by AURKB"; /evidence="ECO:0000250|UniProtKB:P04637"; MOD_RES 305; /note="N6-acetyllysine"; /evidence="ECO:0000250|UniProtKB:P04637"; MOD_RES 315; /note="Phosphoserine; by AURKA, CDK1 and CDK2"; /evidence="ECO:0000250|UniProtKB:P04637"; MOD_RES 321; /note="N6-acetyllysine"; /evidence="ECO:0000250|UniProtKB:P02340"; MOD_RES 333; /note="Omega-N-methylarginine"; /evidence="ECO:0000250|UniProtKB:P04637"; MOD_RES 335; /note="Symmetric dimethylarginine"; /evidence="ECO:0000250|UniProtKB:P04637"; MOD_RES 337; /note="Symmetric dimethylarginine"; /evidence="ECO:0000250|UniProtKB:P04637"; MOD_RES 370; /note="N6,N6-dimethyllysine; alternate"; /evidence="ECO:0000250|UniProtKB:P04637"; MOD_RES 370; /note="N6-methyllysine; by SMYD2; alternate"; /evidence="ECO:0000250|UniProtKB:P04637"; MOD_RES 372; /note="N6-methyllysine; by SETD7"; /evidence="ECO:0000250|UniProtKB:P04637"; MOD_RES 373; /note="N6,N6-dimethyllysine; by EHMT1 and EHMT2; alternate"; /evidence="ECO:0000250|UniProtKB:P04637"; MOD_RES 373; /note="N6-acetyllysine; alternate"; /evidence="ECO:0000250|UniProtKB:P04637"; MOD_RES 381; /note="N6-acetyllysine"; /evidence="ECO:0000250|UniProtKB:P04637"; MOD_RES 382; /note="N6,N6-dimethyllysine; alternate"; /evidence="ECO:0000250|UniProtKB:P04637"; MOD_RES 382; /note="N6-acetyllysine; by KAT6A; alternate"; /evidence="ECO:0000250|UniProtKB:P04637"; MOD_RES 382; /note="N6-methyllysine; by KMT5A; alternate"; /evidence="ECO:0000250|UniProtKB:P04637"; MOD_RES 392; /note="Phosphoserine; by CK2, CDK2 and NUAK1"; /evidence="ECO:0000250|UniProtKB:P04637"
Post Translational Modification PTM: Phosphorylation on Ser residues mediates transcriptional activation. Phosphorylation at Ser-9 by HIPK4 increases repression activity on BIRC5 promoter (By similarity). Phosphorylated on Thr-18 by VRK1, which may prevent the interaction with MDM2. Phosphorylated on Ser-20 by CHEK2 in response to DNA damage, which prevents ubiquitination by MDM2. Phosphorylated on Ser-20 by PLK3 in response to reactive oxygen species (ROS), promoting p53/TP53-mediated apoptosis. Phosphorylated on Thr-55 by TAF1 which promotes MDM2-mediated TP53 degradation. Phosphorylated on Ser-33 by CDK7 in a CAK complex in response to DNA damage. Phosphorylated by HIPK1. Phosphorylated on Ser-46 by HIPK2 upon UV irradiation. Phosphorylation on Ser-46 is required for acetylation by CREBBP. Phosphorylated on Ser-392 following UV but not gamma irradiation. Stabilized by CDK5-mediated phosphorylation in response to genotoxic and oxidative stresses at Ser-15, Ser-33 and Ser-46, leading to accumulation of p53/TP53, particularly in the nucleus, thus inducing the transactivation of p53/TP53 target genes. Phosphorylated by DYRK2 at Ser-46 in response to genotoxic stress. Phosphorylated at Ser-315 and Ser-392 by CDK2 in response to DNA-damage (By similarity). Phosphorylation at Ser-15 is required for interaction with DDX3X and gamma-tubulin (By similarity). {ECO:0000250, ECO:0000250|UniProtKB:P04637}.; PTM: Ubiquitinated by MDM2 and SYVN1, which leads to proteasomal degradation. Ubiquitinated by RFWD3, which works in cooperation with MDM2 and may catalyze the formation of short polyubiquitin chains on p53/TP53 that are not targeted to the proteasome. Ubiquitinated by MKRN1 at Lys-291 and Lys-292, which leads to proteasomal degradation. Deubiquitinated by USP10, leading to stabilize it. Ubiquitinated by TRIM24, RFFL, RNF34 and RNF125, which leads to proteasomal degradation. Ubiquitination by TOPORS induces degradation. Deubiquitination by USP7, leading to stabilize it. Ubiquitinated by COP1, which leads to proteasomal degradation. Ubiquitination and subsequent proteasomal degradation is negatively regulated by CCAR2 (By similarity). {ECO:0000250|UniProtKB:P04637}.; PTM: Monomethylated at Lys-372 by SETD7, leading to stabilization and increased transcriptional activation. Monomethylated at Lys-370 by SMYD2, leading to decreased DNA-binding activity and subsequent transcriptional regulation activity. Lys-372 monomethylation prevents interaction with SMYD2 and subsequent monomethylation at Lys-370. Dimethylated at Lys-373 by EHMT1 and EHMT2. Monomethylated at Lys-382 by KMT5A, promoting interaction with L3MBTL1 and leading to repress transcriptional activity. Demethylation of dimethylated Lys-370 by KDM1A prevents interaction with TP53BP1 and represses TP53-mediated transcriptional activation (By similarity). Monomethylated at Arg-333 and dimethylated at Arg-335 and Arg-337 by PRMT5; methylation is increased after DNA damage and might possibly affect TP53 target gene specificity (By similarity). {ECO:0000250|UniProtKB:P04637}.; PTM: Sumoylated with SUMO1. Sumoylated at Lys-386 by UBC9 (By similarity). {ECO:0000250}.; PTM: Ubiquitinated by MDM2 and SYVN1, which leads to proteasomal degradation. Ubiquitinated by RFWD3, which works in cooperation with MDM2 and may catalyze the formation of short polyubiquitin chains on p53/TP53 that are not targeted to the proteasome. Ubiquitinated by MKRN1, which leads to proteasomal degradation. Deubiquitinated by USP10, leading to stabilize it. Ubiquitinated by TRIM24, RFFL, RNF34 and RNF125, which leads to proteasomal degradation. Ubiquitination by TOPORS induces degradation. Deubiquitination by USP7, leading to stabilize it. Ubiquitinated by COP1, which leads to proteasomal degradation (By similarity). Ubiquitination and subsequent proteasomal degradation is negatively regulated by CCAR2 (By similarity). Polyubiquitinated by C10orf90/FATS, polyubiquitination is 'Lys-48'-linkage independent and non-proteolytic, leading to TP53 stabilization (By similarity). Polyubiquitinated by MUL1 at Lys-24 which leads to proteasomal degradation (By similarity). {ECO:0000250|UniProtKB:P02340, ECO:0000250|UniProtKB:P04637}.; PTM: Acetylated. Acetylation by CREBBP enhances transcriptional activity. Acetylation by EP300. Deacetylation by SIRT1 impairs its ability to induce proapoptotic program and modulate cell senescence. Deacetylation by SIRT2 impairs its ability to induce transcription activation in a AKT-dependent manner. {ECO:0000250|UniProtKB:P04637}.
Signal Peptide
Structure 3D
Cross Reference PDB -
Mapped Pubmed ID -
Motif MOTIF 305..321; /note=Bipartite nuclear localization signal; /evidence=ECO:0000250; MOTIF 339..350; /note=Nuclear export signal; /evidence=ECO:0000250; MOTIF 370..372; /note=[KR]-[STA]-K motif
Gene Encoded By
Mass 43,655
Kinetics
Metal Binding METAL 176; /note=Zinc; /evidence=ECO:0000250; METAL 179; /note=Zinc; /evidence=ECO:0000250; METAL 238; /note=Zinc; /evidence=ECO:0000250; METAL 242; /note=Zinc; /evidence=ECO:0000250
Rhea ID
Cross Reference Brenda