| IED ID | IndEnz0002007488 |
| Enzyme Type ID | protease007488 |
| Protein Name |
Cysteine proteinase inhibitor 1 KCPI1 Phytocystatin allergen Act d 4 |
| Gene Name | |
| Organism | Actinidia deliciosa (Kiwi) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae asterids Ericales Actinidiaceae Actinidia Actinidia deliciosa (Kiwi) |
| Enzyme Sequence | MVPKPLSLLLFLLLALSAAVVGGRKLVAAGGWRPIESLNSAEVQDVAQFAVSEHNKQANDELQYQSVVRGYTQVVAGTNYRLVIAAKDGAVVGNYEAVVWDKPWMHFRNLTSFRKV |
| Enzyme Length | 116 |
| Uniprot Accession Number | Q6TPK4 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Specific inhibitor of papain family cysteine proteinases. Inhibits papain, chymopapain, bromelain, ficin, human cathepsins B, H and L, actinidain and house dustmite endopeptidase 1, but does not inhibit human bleomycin hydrolase. Inhibits papain with an IC(50) of 2.47 nM. Does not inhibit cysteine proteinases belonging to other families including clostripain, streptopain and calpain. {ECO:0000269|PubMed:14697268, ECO:0000269|PubMed:19885843}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Domain (1); Glycosylation (1); Motif (1); Sequence conflict (1); Signal peptide (1); Site (1) |
| Keywords | Allergen;Direct protein sequencing;Glycoprotein;Plant defense;Protease inhibitor;Secreted;Signal;Thiol protease inhibitor |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000250|UniProtKB:P01035}. |
| Modified Residue | |
| Post Translational Modification | PTM: Glycosylated. {ECO:0000269|PubMed:19885843}. |
| Signal Peptide | SIGNAL 1..26; /evidence="ECO:0000269|PubMed:14697268, ECO:0000269|PubMed:15536427, ECO:0000269|PubMed:19885843" |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | MOTIF 73..77; /note=Secondary area of contact; /evidence=ECO:0000250|UniProtKB:P01035 |
| Gene Encoded By | |
| Mass | 12,756 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |