| IED ID | IndEnz0002007490 |
| Enzyme Type ID | protease007490 |
| Protein Name |
Cystatin-S Cystatin-1 Protein LM |
| Gene Name | Cst4 Cyss |
| Organism | Rattus norvegicus (Rat) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Glires (Rodents and rabbits) Rodentia Myomorpha (mice and others) Muroidea Muridae Murinae Rattus Rattus norvegicus (Rat) |
| Enzyme Sequence | MAYLLHAQLFLLTTFILVLNMRLCPVLGHFLGGIEKSSMEEEGASEALNYAVNEYNEKNSDLYLSRVVEVKDVQKQVVAGTKFFFDVILGKTICLKTQGDLTNCPLNEEADQQEHEFCSFVVHDIPWENYIVLLSSSCHSI |
| Enzyme Length | 141 |
| Uniprot Accession Number | P19313 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: This protein strongly inhibits papain and ficin, partially inhibits stem bromelain and bovine cathepsin C, but does not inhibit porcine cathepsin B or clostripain. Papain is inhibited non-competitively. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (2); Motif (1); Sequence conflict (1); Signal peptide (1); Site (1) |
| Keywords | Direct protein sequencing;Disulfide bond;Protease inhibitor;Reference proteome;Secreted;Signal;Thiol protease inhibitor |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..27; /evidence=ECO:0000269|PubMed:2757396 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 10075146; 12005263; 1471486; 15892951; 16651698; 1685882; 1967932; 2022776; 2930478; 3812333; 7575236; 7686006; 7690605; 7749605; 7778093; 7878088; 8374010; 8862019; 9037917; 9447264; 9631169; 9823730; |
| Motif | MOTIF 76..80; /note=Secondary area of contact |
| Gene Encoded By | |
| Mass | 15,949 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |