| IED ID |
IndEnz0002007502 |
| Enzyme Type ID |
protease007502 |
| Protein Name |
Type IV major fimbrial protein FimA
|
| Gene Name |
fimA DNO_0110 |
| Organism |
Dichelobacter nodosus (strain VCS1703A) |
| Taxonomic Lineage |
cellular organisms
Bacteria
Proteobacteria
Gammaproteobacteria
Cardiobacteriales
Cardiobacteriaceae
Dichelobacter
Dichelobacter nodosus (Bacteroides nodosus)
Dichelobacter nodosus (strain VCS1703A)
|
| Enzyme Sequence |
MKSLQKGFTLIELMIVVAIIGILAAFAIPAYNDYIARTQVSEGVSLADGLKIRIADNLQDGKCTSEGDPASGEVGNTDMGKYALATIEGTPDANLAGLTPKDPNGCKVKIEYGKGTAGDNISPLIKGQMLVLNQLVNGSYDKDSSSTVKPKFLPKALKEATP |
| Enzyme Length |
162 |
| Uniprot Accession Number |
A5EWR9 |
| Absorption |
|
| Active Site |
|
| Activity Regulation |
|
| Binding Site |
|
| Calcium Binding |
|
| catalytic Activity |
|
| DNA Binding |
|
| EC Number |
|
| Enzyme Function |
FUNCTION: Major component of the type IV fimbriae that plays an essential role in twitching motility, natural transformation, and protease secretion. {ECO:0000269|PubMed:11443078, ECO:0000269|PubMed:17513472, ECO:0000269|PubMed:18310333}. |
| Temperature Dependency |
|
| PH Dependency |
|
| Pathway |
|
| nucleotide Binding |
|
| Features |
Chain (1); Disulfide bond (1); Modified residue (1); Propeptide (1); Transmembrane (1) |
| Keywords |
Disulfide bond;Fimbrium;Membrane;Methylation;Reference proteome;Transmembrane;Transmembrane helix |
| Interact With |
|
| Induction |
INDUCTION: By PilR (PilR/S system) and RNA polymerase sigma-54 factor/RpoN. {ECO:0000269|PubMed:16788189}. |
| Subcellular Location |
SUBCELLULAR LOCATION: Fimbrium {ECO:0000269|PubMed:18310333}. Membrane {ECO:0000255}; Single-pass membrane protein {ECO:0000255}. |
| Modified Residue |
MOD_RES 8; /note=N-methylphenylalanine; /evidence=ECO:0000255|PROSITE-ProRule:PRU01070 |
| Post Translational Modification |
|
| Signal Peptide |
|
| Structure 3D |
|
| Cross Reference PDB |
- |
| Mapped Pubmed ID |
- |
| Motif |
|
| Gene Encoded By |
|
| Mass |
17,002 |
| Kinetics |
|
| Metal Binding |
|
| Rhea ID |
|
| Cross Reference Brenda |
|