| IED ID | IndEnz0002007510 |
| Enzyme Type ID | protease007510 |
| Protein Name |
Trypsin inhibitor EcTI Cleaved into: Trypsin inhibitor alpha chain; Trypsin inhibitor beta chain |
| Gene Name | |
| Organism | Enterolobium contortisiliquum (Pacara earpod tree) (Mimosa contortisiliqua) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae rosids fabids Fabales Fabaceae Caesalpinioideae mimosoid clade Ingeae Enterolobium Enterolobium contortisiliquum (Pacara earpod tree) (Mimosa contortisiliqua) |
| Enzyme Sequence | KELLDSDGDILRNGGTYYILPALRGKGGGLELAKTGDETCPLNVVQARGETKRGRPAIIWTPPRIAILTPAFYLNIEFQTKDLPACLREYSRLPREEEQHSEVKLAPKEEAAAFGXEKLKPYRDDYKIVYCEGGSDDDSCKDLGISIDDENNRRLVVKDGDPLAVRFVKAHRRG |
| Enzyme Length | 174 |
| Uniprot Accession Number | P86451 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Inhibits trypsin and chymotrypsin with a 1:1 stoichiometry, with dissociation constants of 1.56 nM and 120 nM respectively. Inhibits plasma kallikrein, factor XIIa and plasmin with dissociation constants of 5.0 nM, 150 nM and 18 nM respectively. Does not inhibit factor Xa, thrombin, tissue kallikrein or cysteine proteinases such as papain and bromelain. {ECO:0000269|PubMed:8728712}. |
| Temperature Dependency | BIOPHYSICOCHEMICAL PROPERTIES: Temperature dependence: Activity is retained when heated for 10 minutes up to 60 degrees Celsius. Inactive at 100 degrees Celsius. {ECO:0000269|PubMed:8728712}; |
| PH Dependency | BIOPHYSICOCHEMICAL PROPERTIES: pH dependence: Retains activity after incubation for 10 minutes at pH 2.0 to 12.0. {ECO:0000269|PubMed:8728712}; |
| Pathway | |
| nucleotide Binding | |
| Features | Beta strand (12); Chain (2); Disulfide bond (2); Helix (1); Site (1); Turn (2) |
| Keywords | 3D-structure;Direct protein sequencing;Disulfide bond;Protease inhibitor;Serine protease inhibitor |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | X-ray crystallography (2) |
| Cross Reference PDB | 4J2K; 4J2Y; |
| Mapped Pubmed ID | 23626794; |
| Motif | |
| Gene Encoded By | |
| Mass | 19,457 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |