| IED ID | IndEnz0002007517 |
| Enzyme Type ID | protease007517 |
| Protein Name |
Bark lectin isoform 2 CrataBL CrataBL-form II |
| Gene Name | |
| Organism | Crateva tapia (Garlic-pear tree) (Crataeva tapia) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Capparaceae Crateva Crateva tapia (Garlic-pear tree) (Crataeva tapia) |
| Enzyme Sequence | AILTGVPYYILPSTSRAGFSPDNLRKNTSQLSCPLDLITQLRFPRRIGVPVIFTPQNSSLKVVPLSHNLNIHTCSDLWFCPESKIWTVKSSLTHGGSVVTTGGTFRSLGSWFRIERHGDSYKLVHCPRGSTPCRDVGIETVGGGGRRYLAPRDRPLAVRFTRASG |
| Enzyme Length | 165 |
| Uniprot Accession Number | C0HJA4 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Glucose and N-acetylglucosamine binding lectin. Has hemagglutinating activity against human and rabbit erythrocytes which does not require divalent cations. Inhibits factor Xa and, to a lesser extent, trypsin. Does not inhibit neutrophil elastase, human plasma kallikrein, papain, human plasmin, porcine pancreatic kallikrein and bovin chymotrypsin. Has insecticidal activity against the termite species N.corniger. Induces apoptosis in prostrate cancer cell lines DU145 and PC3. {ECO:0000269|PubMed:22195573, ECO:0000269|PubMed:23823708}. |
| Temperature Dependency | BIOPHYSICOCHEMICAL PROPERTIES: Temperature dependence: Hemagglutinating activity is stable between 30 and 60 degrees Celsius. {ECO:0000269|PubMed:22195573}; |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (2); Glycosylation (2) |
| Keywords | Direct protein sequencing;Disulfide bond;Glycoprotein;Hemagglutinin;Lectin;Protease inhibitor;Serine protease inhibitor;Toxin |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 18,166 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |