| IED ID | IndEnz0002007567 |
| Enzyme Type ID | protease007567 |
| Protein Name |
Proteasome activator complex subunit 1 11S regulator complex subunit alpha REG-alpha Activator of multicatalytic protease subunit 1 Proteasome activator 28 subunit alpha PA28a PA28alpha |
| Gene Name | PSME1 QtrA-14089 |
| Organism | Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Primates Haplorrhini Simiiformes Catarrhini Cercopithecoidea Cercopithecidae (Old World monkeys) Cercopithecinae Macaca (macaques) Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey) |
| Enzyme Sequence | MATLRVQPEAQAKVDVFREDLCTKTENLLGSYFPKKISELDAFLKEPALNEANLSNLKAPLDIPVPDPVKEKEKGERKKQQEKEDKDEKKKGEDEDKGPPCGPVNCNEKILVLLQRLKPEIKDVIEQLNLVTTWLQLQIPRIEDGNNFGVAVQEKVFELMTSLHTKLEGFHTQISKYFSERGDAVTKAAKQPHVGDYRQLVHELDEAEYRDIRLMVMEIRNAYAVLYDIILKNFEKLKKPRGETKGMIY |
| Enzyme Length | 249 |
| Uniprot Accession Number | P58238 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Implicated in immunoproteasome assembly and required for efficient antigen processing. The PA28 activator complex enhances the generation of class I binding peptides by altering the cleavage pattern of the proteasome (By similarity). {ECO:0000250}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Compositional bias (1); Region (1) |
| Keywords | Proteasome;Reference proteome |
| Interact With | |
| Induction | INDUCTION: By interferon gamma. {ECO:0000250}. |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 28,635 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |