| IED ID | IndEnz0002007575 |
| Enzyme Type ID | protease007575 |
| Protein Name |
Proteasome subunit beta type-6 EC 3.4.25.1 Proteasome delta chain Tobacco cryptogein-induced protein 7 tcI 7 |
| Gene Name | |
| Organism | Nicotiana tabacum (Common tobacco) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae asterids lamiids Solanales Solanaceae Nicotianoideae Nicotianeae Nicotiana Nicotiana tabacum (Common tobacco) |
| Enzyme Sequence | MENTDVDQPHSMGTTIIGVTYNGGVVLGADSRTSTGMYVANRASDKITQLTDNVYVCRSGSAADSQIVSDYVRYFLHQHTIQLGQPATVKVAANLTRLLSYNNKDRLQTGMIIGGWDKYEGGKIYGIPPGGTVLEQPFAIGGSGSSYLYGFFDQAWKEGMTQEEAEKLVVTAVSLAIARDGASGGVVRTVTINKDGATRKFYSGDSLQLWHEELEPVNSLLDVVFASSPVPMVS |
| Enzyme Length | 234 |
| Uniprot Accession Number | P93395 |
| Absorption | |
| Active Site | ACT_SITE 14; /note=Nucleophile; /evidence=ECO:0000250 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=Cleavage of peptide bonds with very broad specificity.; EC=3.4.25.1; |
| DNA Binding | |
| EC Number | 3.4.25.1 |
| Enzyme Function | FUNCTION: The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (1); Chain (1); Propeptide (1) |
| Keywords | Cytoplasm;Hydrolase;Nucleus;Protease;Proteasome;Reference proteome;Threonine protease;Zymogen |
| Interact With | |
| Induction | INDUCTION: Up-regulated by elicitins (cryptogein and parasiticein), salicylic acid (SA) and hydrogen peroxide. |
| Subcellular Location | SUBCELLULAR LOCATION: Cytoplasm {ECO:0000255|PROSITE-ProRule:PRU00809}. Nucleus {ECO:0000250}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 25,183 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |