| IED ID | IndEnz0002007618 |
| Enzyme Type ID | protease007618 |
| Protein Name |
Rapid alkalinization factor 23 AtRALF23 Protein RALF-like 23 |
| Gene Name | RALF23 RALFL23 At3g16570 MGL6.2 |
| Organism | Arabidopsis thaliana (Mouse-ear cress) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Camelineae Arabidopsis Arabidopsis thaliana (Mouse-ear cress) |
| Enzyme Sequence | MRGLSRNSGAAAIFAILLILAVHNWSVAVSSQSTEFAGDFPPFETECRGTIAECSVSAALGDGGDLFYGGGEMGEEFEMDSEINRRILATRRYISYGALRRNTIPCSRRGASYYNCRRGAQANPYSRGCSAITRCRRS |
| Enzyme Length | 138 |
| Uniprot Accession Number | Q9LUS7 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Cell signaling peptide that may regulate plant stress, growth, and development. Mediates a rapid alkalinization of extracellular space by mediating a transient increase in the cytoplasmic Ca(2+) concentration leading to a calcium-dependent signaling events through a cell surface receptor and a concomitant activation of some intracellular mitogen-activated protein kinases (By similarity). Regulates negatively brassinolide (BL)-mediated signaling pathway (e.g. BL-induced hypocotyl elongation and branching limitation) (PubMed:19473327). {ECO:0000250, ECO:0000269|PubMed:19473327}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (2); Helix (2); Mutagenesis (1); Propeptide (1); Signal peptide (1); Site (1) |
| Keywords | 3D-structure;Brassinosteroid signaling pathway;Disulfide bond;Hormone;Reference proteome;Secreted;Signal |
| Interact With | |
| Induction | INDUCTION: Repressed by brassinolide (BL) treatment. {ECO:0000269|PubMed:19473327}. |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000250}. |
| Modified Residue | |
| Post Translational Modification | PTM: Proteolytically cleaved, probably by SBT6.1 (S1P), a subtilisin-like serine protease (subtilase). {ECO:0000269|PubMed:19473327}. |
| Signal Peptide | SIGNAL 1..28; /evidence=ECO:0000255 |
| Structure 3D | X-ray crystallography (1) |
| Cross Reference PDB | 6A5E; |
| Mapped Pubmed ID | 27155375; 28174582; 30270181; 31291642; |
| Motif | |
| Gene Encoded By | |
| Mass | 15,049 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |