IED ID | IndEnz0002007636 |
Enzyme Type ID | protease007636 |
Protein Name |
25 kDa core protein A12L Cleaved into: 17 kDa core protein A12L 17K |
Gene Name | A12L |
Organism | Variola virus (isolate Human/India/Ind3/1967) (VARV) (Smallpox virus) |
Taxonomic Lineage | Viruses Varidnaviria Bamfordvirae Nucleocytoviricota Pokkesviricetes Chitovirales Poxviridae Chordopoxvirinae Orthopoxvirus Variola virus Variola virus (isolate Human/India/Ind3/1967) (VARV) (Smallpox virus) |
Enzyme Sequence | MADKKNLAVRSSYDDYIETVNKITPQLKNLLAQIGGDAAVKGGNNNLNSQTDVTAGACDTKSKSSKCITCKSKSSSSSTSTSKSSKNTSGAPRRRTTATTSFNAMDGQIVQAVTNAGKIVYGTVRDGQLEVRGMVGEINHDLLGIESVNAGKKKPSKKMPTNKKINMSSGMRRQEQINPNDCCLDMGMY |
Enzyme Length | 189 |
Uniprot Accession Number | P0DOK9 |
Absorption | |
Active Site | |
Activity Regulation | |
Binding Site | |
Calcium Binding | |
catalytic Activity | |
DNA Binding | |
EC Number | |
Enzyme Function | FUNCTION: Component of the virion core that undergoes proteolytic processing during the immature virion (IV) to mature virion (MV) transition. Essential for the formation of a structurally normal core (By similarity). {ECO:0000250}. |
Temperature Dependency | |
PH Dependency | |
Pathway | |
nucleotide Binding | |
Features | Chain (2); Region (2); Site (1) |
Keywords | Late protein;Reference proteome;Virion |
Interact With | |
Induction | INDUCTION: Expressed in the late phase of the viral replicative cycle. |
Subcellular Location | SUBCELLULAR LOCATION: [25 kDa core protein A12L]: Virion {ECO:0000250}. Note=Localizes to the virion core. {ECO:0000250}.; SUBCELLULAR LOCATION: [17 kDa core protein A12L]: Virion {ECO:0000250}. Note=Localizes to the virion core. {ECO:0000250}. |
Modified Residue | |
Post Translational Modification | PTM: The 25-kDa precursor is cleaved to a mature protein of 17 kDa during virion maturation. Further proteolytic processing is supposed to occur since five more A12L-derived products have been observed (By similarity). {ECO:0000250}. |
Signal Peptide | |
Structure 3D | |
Cross Reference PDB | - |
Mapped Pubmed ID | - |
Motif | |
Gene Encoded By | |
Mass | 20,192 |
Kinetics | |
Metal Binding | |
Rhea ID | |
Cross Reference Brenda |