| IED ID | IndEnz0002007656 |
| Enzyme Type ID | protease007656 |
| Protein Name |
KDEL-tailed cysteine endopeptidase CEP1 EC 3.4.22.- Cysteine proteinase CP56 AtCP56 |
| Gene Name | CEP1 CP56 At5g50260 K6A12.12 |
| Organism | Arabidopsis thaliana (Mouse-ear cress) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Camelineae Arabidopsis Arabidopsis thaliana (Mouse-ear cress) |
| Enzyme Sequence | MKRFIVLALCMLMVLETTKGLDFHNKDVESENSLWELYERWRSHHTVARSLEEKAKRFNVFKHNVKHIHETNKKDKSYKLKLNKFGDMTSEEFRRTYAGSNIKHHRMFQGEKKATKSFMYANVNTLPTSVDWRKNGAVTPVKNQGQCGSCWAFSTVVAVEGINQIRTKKLTSLSEQELVDCDTNQNQGCNGGLMDLAFEFIKEKGGLTSELVYPYKASDETCDTNKENAPVVSIDGHEDVPKNSEDDLMKAVANQPVSVAIDAGGSDFQFYSEGVFTGRCGTELNHGVAVVGYGTTIDGTKYWIVKNSWGEEWGEKGYIRMQRGIRHKEGLCGIAMEASYPLKNSNTNPSRLSLDSLKDEL |
| Enzyme Length | 361 |
| Uniprot Accession Number | Q9FGR9 |
| Absorption | |
| Active Site | ACT_SITE 150; /evidence=ECO:0000255|PROSITE-ProRule:PRU10088; ACT_SITE 286; /evidence=ECO:0000255|PROSITE-ProRule:PRU10089; ACT_SITE 307; /evidence=ECO:0000255|PROSITE-ProRule:PRU10090 |
| Activity Regulation | ACTIVITY REGULATION: Inhibited by leupeptin and the cysteine protease inhibitor E-64. {ECO:0000269|PubMed:25035401}. |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.4.22.- |
| Enzyme Function | FUNCTION: Possesses protease activity in vitro (PubMed:25035401). Involved in the final stage of developmental programmed cell death and in intercalation of new cells. Cleaves extensins, thus probably supporting the final cell collapse (PubMed:21632425). During the compatible interaction with the biotrophic powdery mildew fungus Erysiphe cruciferarum, involved in the control of late epidermal cell death that limits growth and susceptibility to the parasite (PubMed:24605116). During anther development, involved in tapetal programmed cell death (PCD), leading to degeneration of tapetal cells and functional pollen formation (PubMed:25035401). {ECO:0000269|PubMed:21632425, ECO:0000269|PubMed:24605116, ECO:0000269|PubMed:25035401}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (3); Chain (1); Disulfide bond (3); Motif (1); Propeptide (1); Signal peptide (1) |
| Keywords | Disulfide bond;Endoplasmic reticulum;Hydrolase;Plant defense;Protease;Reference proteome;Signal;Thiol protease;Vacuole;Zymogen |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Endoplasmic reticulum {ECO:0000255|PROSITE-ProRule:PRU10138, ECO:0000269|PubMed:24605116}. Vacuole {ECO:0000269|PubMed:25035401}. Note=During anther development, detected as a proenzyme in precursor protease vesicles in tapetum cells and then transported to the vacuole and transformed into the mature enzyme before rupture of the vacuole. {ECO:0000269|PubMed:25035401}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..20; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 14682612; 14697270; 15375205; 15965014; 18252252; 18650403; 18831797; 27349421; 28846731; 30376110; 30576358; 31279878; 31858133; |
| Motif | MOTIF 358..361; /note=Prevents secretion from ER; /evidence=ECO:0000255|PROSITE-ProRule:PRU10138 |
| Gene Encoded By | |
| Mass | 40,708 |
| Kinetics | BIOPHYSICOCHEMICAL PROPERTIES: Kinetic parameters: KM=13.92 uM for Z-Phe-Arg-NHMec {ECO:0000269|PubMed:25035401}; KM=159.62 uM for Z-Arg-NHMec {ECO:0000269|PubMed:25035401}; Vmax=235.14 pmol/sec/mg enzyme toward Z-Phe-Arg-NHMec {ECO:0000269|PubMed:25035401}; Vmax=537.93 pmol/sec/mg enzyme toward Z-Arg-NHMec {ECO:0000269|PubMed:25035401}; |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |