| IED ID | IndEnz0002007660 |
| Enzyme Type ID | protease007660 |
| Protein Name |
Degradation enzyme regulation protein DegQ Regulatory factor SacQ |
| Gene Name | degQ sacQ BLi03360 BL02609 |
| Organism | Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46) |
| Taxonomic Lineage | cellular organisms Bacteria Terrabacteria group Firmicutes Bacilli Bacillales Bacillaceae Bacillus Bacillus subtilis group Bacillus licheniformis Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46) |
| Enzyme Sequence | MEKQQIEELKQLLWRLENEIRETKDSLRKINKSIDQYDKYTYLKTS |
| Enzyme Length | 46 |
| Uniprot Accession Number | P69889 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Stimulates the phosphotransfer from phospho-DegS to DegU. Affects protease and levansucrose production (By similarity). {ECO:0000250}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1) |
| Keywords | Reference proteome |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 5,748 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |