| IED ID | IndEnz0002007673 |
| Enzyme Type ID | protease007673 |
| Protein Name |
Proteinase inhibitor type-2 K Proteinase inhibitor type II K IIK Cleaved into: Proteinase inhibitor PCI-1 Proteinase inhibitor PCI-I |
| Gene Name | PIN2K |
| Organism | Solanum tuberosum (Potato) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae asterids lamiids Solanales Solanaceae Solanoideae Solaneae Solanum Solanum tuberosum (Potato) |
| Enzyme Sequence | MDVHKEVNFVAYLLIVLGLLVLVSAMDVDAKACIRECGNLGFGICPRSEGSPENPICTNCCAGYKGCNYYSANGAFICEGQSDPKKPKACPLNCDPHIAYSKCPRSEGKSLIYPTGCTTCCTGYKGCYYFGKNGKFVCEGESDEPKANMYPAM |
| Enzyme Length | 153 |
| Uniprot Accession Number | P01080 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Inhibitor of trypsin and chymotrypsin. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Beta strand (3); Chain (2); Disulfide bond (8); Repeat (2); Sequence conflict (6); Signal peptide (1); Site (2); Turn (1) |
| Keywords | 3D-structure;Disulfide bond;Protease inhibitor;Reference proteome;Repeat;Serine protease inhibitor;Signal |
| Interact With | |
| Induction | INDUCTION: By wounding. |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..25; /evidence=ECO:0000255 |
| Structure 3D | X-ray crystallography (1) |
| Cross Reference PDB | 4SGB; |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 16,505 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |