| IED ID | IndEnz0002007748 |
| Enzyme Type ID | protease007748 |
| Protein Name |
ATP-dependent Clp protease proteolytic subunit EC 3.4.21.92 Endopeptidase Clp |
| Gene Name | clpP |
| Organism | Cuscuta gronovii (Common dodder) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae asterids lamiids Solanales Convolvulaceae Cuscuteae (dodders) Cuscuta Cuscuta subgen. Grammica Cuscuta sect. Oxycarpae Cuscuta gronovii (Common dodder) |
| Enzyme Sequence | MPIGVPRVRFLYDEDTGQVWIDIYNRLYRERCLFLTHTINTKIGNQLAGLFIYLGIQDDPKDIFFFLNSPGGGIISGLAIYDSMQVVRPDTQTICVGLAASMACFLLVGGTITKRLAFPHARVMMHQPLSTFFETQTGDAVMEVDELLKMRENLIEVYAQRTGKPHWVISEDIERDVFLSPTEAKTYGLVDVVGVTLI |
| Enzyme Length | 198 |
| Uniprot Accession Number | A7M922 |
| Absorption | |
| Active Site | ACT_SITE 101; /note=Nucleophile; /evidence=ECO:0000250; ACT_SITE 126; /evidence=ECO:0000250 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=Hydrolysis of proteins to small peptides in the presence of ATP and magnesium. Alpha-casein is the usual test substrate. In the absence of ATP, only oligopeptides shorter than five residues are hydrolyzed (such as succinyl-Leu-Tyr-|-NHMec, and Leu-Tyr-Leu-|-Tyr-Trp, in which cleavage of the -Tyr-|-Leu- and -Tyr-|-Trp bonds also occurs).; EC=3.4.21.92; |
| DNA Binding | |
| EC Number | 3.4.21.92 |
| Enzyme Function | FUNCTION: Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins (By similarity). {ECO:0000250}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (2); Chain (1) |
| Keywords | Hydrolase;Plastid;Protease;Serine protease |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Plastid. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | Plastid |
| Mass | 22,294 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |