| IED ID | IndEnz0002007754 |
| Enzyme Type ID | protease007754 |
| Protein Name |
Protein ImpA EC 3.4.21.- Cleaved into: Protein ImpA' |
| Gene Name | impA |
| Organism | Shigella flexneri |
| Taxonomic Lineage | cellular organisms Bacteria Proteobacteria Gammaproteobacteria Enterobacterales Enterobacteriaceae Shigella Shigella flexneri |
| Enzyme Sequence | MSTVYHRPADPSGDDSYVRPLFADRCQAGFPSPATDYAEQELDLNSYCISRPAATFFLRASGESMNQAGVQNGDLLVVDRAEKPQHGDIVIAEIDGEFTVKRLLLRPRPALEPVSDSPEFRTLYPENICIFGVVTHVIHRTRELR |
| Enzyme Length | 145 |
| Uniprot Accession Number | Q7BSM9 |
| Absorption | |
| Active Site | ACT_SITE 64; /note=For autocatalytic cleavage activity; /evidence=ECO:0000250; ACT_SITE 101; /note=For autocatalytic cleavage activity; /evidence=ECO:0000250 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.4.21.- |
| Enzyme Function | FUNCTION: Involved in UV protection and mutation. {ECO:0000250}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (2); Chain (2); Site (1) |
| Keywords | Autocatalytic cleavage;DNA damage;DNA repair;Hydrolase;Plasmid;Protease;SOS mutagenesis;SOS response;Serine protease |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | Plasmid 90 kb virulence |
| Mass | 16,219 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |