Detail Information for IndEnz0002007767
IED ID IndEnz0002007767
Enzyme Type ID protease007767
Protein Name Lipoprotein signal peptidase
EC 3.4.23.36
Prolipoprotein signal peptidase
Signal peptidase II
SPase II
Gene Name lspA LMOf2365_1872
Organism Listeria monocytogenes serotype 4b (strain F2365)
Taxonomic Lineage cellular organisms Bacteria Terrabacteria group Firmicutes Bacilli Bacillales Listeriaceae Listeria Listeria monocytogenes Listeria monocytogenes serotype 4b Listeria monocytogenes serotype 4b (strain F2365)
Enzyme Sequence MYYYLITLAVIALDQLTKWIVVQNMEIGQKIEVIPGFLYWTSYRNDGAAWSILEGHMWFFYLITVVVIGIIIYIMQKYAKGKRLFSISLAFILGGAIGNFIDRVLHQEVVDFVQTVWGNYYFPIFNVADAALSVGVVLMLVYVFVDDRKTKGIK
Enzyme Length 154
Uniprot Accession Number Q71YH2
Absorption
Active Site ACT_SITE 111; /evidence=ECO:0000255|HAMAP-Rule:MF_00161; ACT_SITE 129; /evidence=ECO:0000255|HAMAP-Rule:MF_00161
Activity Regulation
Binding Site
Calcium Binding
catalytic Activity CATALYTIC ACTIVITY: Reaction=Release of signal peptides from bacterial membrane prolipoproteins. Hydrolyzes -Xaa-Yaa-Zaa-|-(S,diacylglyceryl)Cys-, in which Xaa is hydrophobic (preferably Leu), and Yaa (Ala or Ser) and Zaa (Gly or Ala) have small, neutral side chains.; EC=3.4.23.36; Evidence={ECO:0000255|HAMAP-Rule:MF_00161};
DNA Binding
EC Number 3.4.23.36
Enzyme Function FUNCTION: This protein specifically catalyzes the removal of signal peptides from prolipoproteins. {ECO:0000255|HAMAP-Rule:MF_00161}.
Temperature Dependency
PH Dependency
Pathway PATHWAY: Protein modification; lipoprotein biosynthesis (signal peptide cleavage). {ECO:0000255|HAMAP-Rule:MF_00161}.
nucleotide Binding
Features Active site (2); Chain (1); Transmembrane (3)
Keywords Aspartyl protease;Cell membrane;Hydrolase;Membrane;Protease;Transmembrane;Transmembrane helix
Interact With
Induction
Subcellular Location SUBCELLULAR LOCATION: Cell membrane {ECO:0000255|HAMAP-Rule:MF_00161}; Multi-pass membrane protein {ECO:0000255|HAMAP-Rule:MF_00161}.
Modified Residue
Post Translational Modification
Signal Peptide
Structure 3D
Cross Reference PDB -
Mapped Pubmed ID -
Motif
Gene Encoded By
Mass 17,707
Kinetics
Metal Binding
Rhea ID
Cross Reference Brenda