| IED ID | IndEnz0002007770 |
| Enzyme Type ID | protease007770 |
| Protein Name |
Metallocarboxypeptidase inhibitor Leech carboxypeptidase inhibitor LCI |
| Gene Name | |
| Organism | Hirudo medicinalis (Medicinal leech) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Protostomia Spiralia Lophotrochozoa Annelida Clitellata Hirudinea (leeches) Hirudinida Hirudiniformes Hirudinidae Hirudo Hirudo medicinalis (Medicinal leech) |
| Enzyme Sequence | MFLLVFLCCLHLVISSHTPDESFLCYQPDQVCCFICRGAAPLPSEGECNPHPTAPWCREGAVEWVPYSTGQCRTTCIPYVE |
| Enzyme Length | 81 |
| Uniprot Accession Number | P81511 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Tightly binding, competitive inhibitor of different types of pancreatic-like carboxypeptidases. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Beta strand (5); Chain (1); Disulfide bond (4); Helix (2); Signal peptide (1); Site (1) |
| Keywords | 3D-structure;Direct protein sequencing;Disulfide bond;Metalloenzyme inhibitor;Metalloprotease inhibitor;Protease inhibitor;Signal |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..15; /evidence=ECO:0000269|PubMed:9830043 |
| Structure 3D | NMR spectroscopy (3); X-ray crystallography (2) |
| Cross Reference PDB | 1DTD; 1DTV; 1ZFI; 1ZFL; 2ABZ; |
| Mapped Pubmed ID | 15226306; 16084391; 16126224; |
| Motif | |
| Gene Encoded By | |
| Mass | 9,068 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |