| IED ID | IndEnz0002007780 |
| Enzyme Type ID | protease007780 |
| Protein Name |
Membrane-embedded CAAX protease MroQ EC 3.4.-.- |
| Gene Name | MroQ |
| Organism | Staphylococcus aureus (strain USA300) |
| Taxonomic Lineage | cellular organisms Bacteria Terrabacteria group Firmicutes Bacilli Bacillales Staphylococcaceae Staphylococcus Staphylococcus aureus Staphylococcus aureus (strain USA300) |
| Enzyme Sequence | MTRLWASLLTVIIYILSQFLPLLIVKKLPFVQYSGIELTKAVIYIQLVLFLIAATTIILINLKIKNPTKLELEVKEPKKYIIPWALLGFALVMIYQMVVSIVLTQIYGGQQVSPNTEKLIIIARKIPIFIFFVSIIGPLLEEYVFRKVIFGELFNAIKGNRIVAFIIATTVSSLIFALAHNDFKFIPVYFGMGVIFSLAYVWTKRLAVPIIIHMLQNGFVVIFQLLNPEALKKATEQANFIYHIFIP |
| Enzyme Length | 247 |
| Uniprot Accession Number | A0A0H2XEK8 |
| Absorption | |
| Active Site | ACT_SITE 141; /evidence=ECO:0000305|PubMed:30833334 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.4.-.- |
| Enzyme Function | FUNCTION: Participates in the regulation of the Agr quorum sensing activity and plays thereby an important role in virulence (PubMed:30833335, PubMed:30833334). Mechanistically, elicits a protease dependent control of Agr activity without playing a role in the processing of the pheromone-precursor AgrD (PubMed:30833335). {ECO:0000269|PubMed:30833334, ECO:0000269|PubMed:30833335}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (1); Chain (1); Mutagenesis (5); Signal peptide (1); Transmembrane (5) |
| Keywords | Hydrolase;Membrane;Protease;Signal;Transmembrane;Transmembrane helix;Virulence |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Membrane {ECO:0000255}; Multi-pass membrane protein {ECO:0000255}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..17; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 28,163 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |