| IED ID | IndEnz0002007837 |
| Enzyme Type ID | protease007837 |
| Protein Name |
Serpentine receptor class r-10 Odorant response abnormal protein 10 Olfactory receptor 10 |
| Gene Name | odr-10 C53B7.5 |
| Organism | Caenorhabditis elegans |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Protostomia Ecdysozoa Nematoda (roundworms) Chromadorea Rhabditida Rhabditina Rhabditomorpha Rhabditoidea Rhabditidae Peloderinae Caenorhabditis Caenorhabditis elegans |
| Enzyme Sequence | MSGELWITLVDTADIVGVTLTFCVNIVLLGLLKTRGKNLGTYKYLMAFFSVFSIFYAIIEFILRPIMHIENTTFFLISRKRFNYSTKLGKINSAFYCACFATSFVVSGVHFVYRYFATCKPNLLRLFNLPTLLLWPLGCSVPVTMWASVSYFLYPDTEYTEAAVTNVLNNHYNWIKKENVSYIAYVYYQYENGVRHIYLKNLLGCFVHYFVMSMTFVVMFYCGYATWKTMNEHKDVSDRTRALQKQLFKALVLQTLIPTIFMYAPTGVMFIAPFFDVNLNANANFIVFCSFLYPGLDPLILILIIRDFRRTIFNFLCGKKNSVDESRSTTRANLSQVPT |
| Enzyme Length | 339 |
| Uniprot Accession Number | Q18807 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: An odorant receptor which affects chemotaxis to the volatile odorant diacetyl. Specifies AWA neuronal cell fate via the odr-7 pathway. {ECO:0000269|PubMed:10421632, ECO:0000269|PubMed:8601313}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Glycosylation (3); Mutagenesis (1); Topological domain (8); Transmembrane (7) |
| Keywords | Cell membrane;Cell projection;Chemotaxis;Cilium;Glycoprotein;Membrane;Olfaction;Receptor;Reference proteome;Sensory transduction;Transmembrane;Transmembrane helix |
| Interact With | |
| Induction | INDUCTION: Induced upon exposure to the volatile odorant diacetyl. {ECO:0000269|PubMed:8601313}. |
| Subcellular Location | SUBCELLULAR LOCATION: Cell projection, cilium membrane {ECO:0000269|PubMed:24603482, ECO:0000269|PubMed:26150102, ECO:0000269|PubMed:8601313}; Multi-pass membrane protein {ECO:0000269|PubMed:24603482, ECO:0000269|PubMed:8601313}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 10409513; 10517638; 10571181; 11493519; 12097347; 15723796; 17314406; 18801967; 22342749; 22560298; 23800452; 24782565; 25254556; 25415379; 25438941; 25487147; 9342380; |
| Motif | |
| Gene Encoded By | |
| Mass | 39,227 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |