| IED ID | IndEnz0002007840 |
| Enzyme Type ID | protease007840 |
| Protein Name |
Protease-associated domain-containing protein 1 Protease-associated domain-containing protein of 21 kDa |
| Gene Name | Pradc1 Pap21 |
| Organism | Mus musculus (Mouse) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Glires (Rodents and rabbits) Rodentia Myomorpha (mice and others) Muroidea Muridae Murinae Mus Mus Mus musculus (Mouse) |
| Enzyme Sequence | MSRGAAGWCCLVLWLPTCVAAHGLRIHDYLYFQVLSPGDIRYIFTATPAKDFGGIFHTRYEQIHLVPAEPPEACGELSNGFFIQDQIALVERGGCSFLSKTRVVQEHGGRAVIISDNAVDNDSFYVEMIQDSTQRTADIPALFLLGRDGYMIRRSLEQHGLPWAIISIPVNVTSIPTFELLQPPWTFW |
| Enzyme Length | 188 |
| Uniprot Accession Number | Q9D9N8 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Plays a role in the modulation of physical activity and adiposity. {ECO:0000269|PubMed:31689374}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Domain (1); Glycosylation (2); Signal peptide (1) |
| Keywords | Glycoprotein;Reference proteome;Secreted;Signal |
| Interact With | |
| Induction | INDUCTION: Expression in metabolically active tissues is significantly suppressed by refeeding. {ECO:0000269|PubMed:31689374}. |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000250|UniProtKB:Q9BSG0}. |
| Modified Residue | |
| Post Translational Modification | PTM: N-glycosylated; required for efficient secretion. {ECO:0000250|UniProtKB:Q9BSG0}. |
| Signal Peptide | SIGNAL 1..21; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 11217851; 12466851; 12520002; 14610273; 16602821; 18799693; 21267068; 21677750; |
| Motif | |
| Gene Encoded By | |
| Mass | 21,085 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |