| IED ID | IndEnz0002007871 |
| Enzyme Type ID | protease007871 |
| Protein Name |
Low choriolytic enzyme EC 3.4.24.66 Choriolysin L Hatching enzyme zinc-protease subunit LCE |
| Gene Name | lce |
| Organism | Oryzias latipes (Japanese rice fish) (Japanese killifish) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Actinopterygii Actinopteri Neopterygii Teleostei Osteoglossocephalai Clupeocephala Euteleosteomorpha Neoteleostei Eurypterygia Ctenosquamata Acanthomorphata Euacanthomorphacea Percomorphaceae Ovalentaria Atherinomorphae Beloniformes (medakas needlefish and others) Adrianichthyoidei Adrianichthyidae Oryziinae (medakas) Oryzias Oryzias latipes (Japanese rice fish) (Japanese killifish) |
| Enzyme Sequence | MDLLAKASVLLLLLLSLSNAQTDNMEEAENGSSKEEIDESELEDVSSIIFRMNNNSMEELLEGDLVLPKTRNAMKCFGAPDSCRWPKSSNGIVKVPYVVSDNYESDEKETIRNAMKEFAEKTCIHFVPRNNERAYLSLEPRFGCKSMMGYVGDKQVVVLQRFGCIKHAVIQHELLHALGFYHEHTRSDRDQHVKINWENIIKDFTHNFDKNDTDNLGTPYDYGSIMHYGRTAFGKDRKETITPIPNPKAAIGQTERMSDIDILRVNKLYKC |
| Enzyme Length | 271 |
| Uniprot Accession Number | P31579 |
| Absorption | |
| Active Site | ACT_SITE 173; /evidence=ECO:0000255|PROSITE-ProRule:PRU01211 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=Hydrolysis of the inner layer of fish egg envelope. Also hydrolysis of casein and small molecule substrates such as succinyl-Leu-Leu-Val-Tyr-|-7-(4-methyl)coumarylamide.; EC=3.4.24.66; |
| DNA Binding | |
| EC Number | 3.4.24.66 |
| Enzyme Function | FUNCTION: Participates in the breakdown of the egg envelope, which is derived from the egg extracellular matrix, at the time of hatching. Thus allowing the newly hatched fish to swim free. LCE solubilizes the egg envelope only after it has been swollen by the action of HCE. {ECO:0000303|PubMed:1397682}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (1); Chain (1); Disulfide bond (3); Domain (1); Glycosylation (3); Metal binding (3); Propeptide (1); Sequence conflict (2); Signal peptide (1) |
| Keywords | Cytoplasmic vesicle;Direct protein sequencing;Disulfide bond;Glycoprotein;Hydrolase;Metal-binding;Metalloprotease;Protease;Reference proteome;Signal;Zinc;Zymogen |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Zymogen granule {ECO:0000269|PubMed:1397682}. Note=Stored as proenzymes in the zymogen granules. {ECO:0000269|PubMed:1397682}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..20 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 30,985 |
| Kinetics | |
| Metal Binding | METAL 172; /note=Zinc; via tele nitrogen; catalytic; /evidence=ECO:0000255|PROSITE-ProRule:PRU01211; METAL 176; /note=Zinc; via tele nitrogen; catalytic; /evidence=ECO:0000255|PROSITE-ProRule:PRU01211; METAL 182; /note=Zinc; via tele nitrogen; catalytic; /evidence=ECO:0000255|PROSITE-ProRule:PRU01211 |
| Rhea ID | |
| Cross Reference Brenda |