Detail Information for IndEnz0002007872
IED ID IndEnz0002007872
Enzyme Type ID protease007872
Protein Name Prepilin leader peptidase/N-methyltransferase
Includes: Leader peptidase
EC 3.4.23.43
Prepilin peptidase
; N-methyltransferase
EC 2.1.1.-
Gene Name gspO BP1026B_I0298
Organism Burkholderia pseudomallei (strain 1026b)
Taxonomic Lineage cellular organisms Bacteria Proteobacteria Betaproteobacteria Burkholderiales Burkholderiaceae Burkholderia pseudomallei group Burkholderia pseudomallei (Pseudomonas pseudomallei) Burkholderia pseudomallei (strain 1026b)
Enzyme Sequence MPTASMTPNPFLSGSPEHAAAAGPLAAFAALPTGMQLAFAIVLGLVVGSFLNVVVHRLPIMMKRAWLAEIAEATGAPCADDSLPARYNLCVPRSACPHCGHALRAWENVPVLSYIALRGRCRHCRTPIGARYPLIELASGALAAGALALFGPSGAALAAFGLCAALLAMSAIDMQTGFLPDSLTLPLLWAGLCVNLWGTFASLRAAVIGAIAGYLFLWCILWLFKLLRGIEGIGYGDLKLLAALGAWLGWEALPQVVLIAAVAGAAVGLVATWRGRMRFEEPLPFGPFLAAGGAATLFFGTPFYLLLGG
Enzyme Length 309
Uniprot Accession Number I1WFC0
Absorption
Active Site
Activity Regulation
Binding Site
Calcium Binding
catalytic Activity CATALYTIC ACTIVITY: Reaction=Typically cleaves a -Gly-|-Phe- bond to release an N-terminal, basic peptide of 5-8 residues from type IV prepilin, and then N-methylates the new N-terminal amino group, the methyl donor being S-adenosyl-L-methionine.; EC=3.4.23.43; Evidence={ECO:0000250|UniProtKB:P22610};
DNA Binding
EC Number 3.4.23.43; 2.1.1.-
Enzyme Function FUNCTION: Plays an essential role in type IV pili and type II pseudopili formation by proteolytically removing the leader sequence from substrate proteins and subsequently monomethylating the alpha-amino group of the newly exposed N-terminal phenylalanine. {ECO:0000250|UniProtKB:P22610}.
Temperature Dependency
PH Dependency
Pathway
nucleotide Binding
Features Chain (1); Erroneous initiation (1); Metal binding (4); Transmembrane (7)
Keywords Cell inner membrane;Cell membrane;Hydrolase;Membrane;Metal-binding;Methyltransferase;Multifunctional enzyme;Protease;S-adenosyl-L-methionine;Transferase;Transmembrane;Transmembrane helix;Zinc
Interact With
Induction
Subcellular Location SUBCELLULAR LOCATION: Cell inner membrane {ECO:0000250|UniProtKB:P22610}; Multi-pass membrane protein {ECO:0000250|UniProtKB:P22610}.
Modified Residue
Post Translational Modification
Signal Peptide
Structure 3D
Cross Reference PDB -
Mapped Pubmed ID -
Motif
Gene Encoded By
Mass 32,224
Kinetics
Metal Binding METAL 96; /note=Zinc; /evidence=ECO:0000250|UniProtKB:P22610; METAL 99; /note=Zinc; /evidence=ECO:0000250|UniProtKB:P22610; METAL 121; /note=Zinc; /evidence=ECO:0000250|UniProtKB:P22610; METAL 124; /note=Zinc; /evidence=ECO:0000250|UniProtKB:P22610
Rhea ID
Cross Reference Brenda