| IED ID | IndEnz0002007918 |
| Enzyme Type ID | protease007918 |
| Protein Name |
Protein 33K L4-33K Splicing factor 33K Terminase, small subunit |
| Gene Name | L4 |
| Organism | Human adenovirus F serotype 40 (HAdV-40) (Human adenovirus 40) |
| Taxonomic Lineage | Viruses Varidnaviria Bamfordvirae Preplasmiviricota Tectiliviricetes Rowavirales Adenoviridae Mastadenovirus Human mastadenovirus F Human adenovirus F serotype 40 (HAdV-40) (Human adenovirus 40) |
| Enzyme Sequence | MPPKGNKHPIAQRQSQQKLQKQWDEEETWDDSQAEEVSDEEAEEQMESWDSLDEEDLEDVEEETIASDKAPSFKKPVRSQPPKTIPPLPPQPCSLKASRRWDTVSIAGSPTAPAAPTKRLEKTPRVRKTSSAIATRQDSPATQELRKRIFPTLYAIFQQSRGQQLELKVKNRSLRSLTRSCLYHRSEDQLQRTLEDAEALFNKYCSVSLKD |
| Enzyme Length | 211 |
| Uniprot Accession Number | P11805 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Promotes alternative splicing of late transcripts by promoting splicing at weak 3' splice sites. Required for the temporal activation of major late pre-mRNA splicing at late times of infection. Induces the splicing and expression of the late capsid vertex protein (By similarity). {ECO:0000250}.; FUNCTION: Probably functions as the small terminase that is part of the molecular motor that translocates genomic DNA in empty capsid during DNA packaging. This motor is located at a unique vertex and comprises at least the IVa2 ATPase, the small terminase 33K and probably a portal. Forms a ring-like structure of about 17 nm in which genomic DNA is translocated into the capsid. Stimulates IVa2 ATPase activity in the presence of the viral genome. Once the DNA is packaged, the terminase detaches: the 33K protein is present in the empty particles, but not in the mature virions. Also involved in virion assembly. {ECO:0000250|UniProtKB:P24940}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Compositional bias (1); Region (4) |
| Keywords | Alternative splicing;Host nucleus;Host-virus interaction;Late protein;Phosphoprotein;Viral capsid assembly;Viral genome packaging;Viral release from host cell;mRNA processing |
| Interact With | |
| Induction | INDUCTION: Expressed in the late phase of the viral replicative cycle. |
| Subcellular Location | SUBCELLULAR LOCATION: Host nucleus {ECO:0000250|UniProtKB:P24940}. Note=At late time of infection, reorganized from the nuclear margin to ring-like structures at viral replication centers. {ECO:0000250|UniProtKB:P24940}. |
| Modified Residue | |
| Post Translational Modification | PTM: Phosphorylated in vitro by human PKA and PRKDC. PRKDC inhibits, whereas PKA activates the splicing factor (By similarity). {ECO:0000250}. |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 24,162 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |