| IED ID | IndEnz0002007932 |
| Enzyme Type ID | protease007932 |
| Protein Name |
Ninjurin-1 Nerve injury-induced protein 1 Cleaved into: Secreted ninjurin-1 Soluble ninjurin-1 sNinJ1 |
| Gene Name | Ninj1 |
| Organism | Mus musculus (Mouse) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Glires (Rodents and rabbits) Rodentia Myomorpha (mice and others) Muroidea Muridae Murinae Mus Mus Mus musculus (Mouse) |
| Enzyme Sequence | MESGTEEYELNGDLRPGSPGSPDALPPRWGLRNRPINVNHYANKKSAAESMLDIALLMANASQLKAVVEQGNDFAFFVPLVVLISISLVLQIGVGVLLIFLVKYDLNNPAKHAKLDFLNNLATGLVFIIVVVNIFITAFGVQKPVMDVAPRQ |
| Enzyme Length | 152 |
| Uniprot Accession Number | O70131 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: [Ninjurin-1]: Homophilic transmembrane adhesion molecule involved in various processes such as inflammation, cell death, axonal growth, cell chemotaxis and angiogenesis (PubMed:19557008, PubMed:24347169, PubMed:24917672, PubMed:31526566, PubMed:33472215). Promotes cell adhesion by mediating homophilic interactions via its extracellular N-terminal adhesion motif (N-NAM) (PubMed:24917672, PubMed:30510259). Involved in the progression of the inflammatory stress by promoting cell-to-cell interactions between immune cells and endothelial cells (PubMed:24917672, PubMed:30510259). Involved in leukocyte migration during inflammation by promoting transendothelial migration of macrophages via homotypic binding (PubMed:24917672). Promotes the migration of monocytes across the brain endothelium to central nervous system inflammatory lesions (By similarity). Acts as a regulator of Toll-like receptor 4 (TLR4) signaling triggered by lipopolysaccharide (LPS) during systemic inflammation; directly binds LPS (PubMed:25860173). Acts as a mediator of both programmed and necrotic cell death (PubMed:19557008, PubMed:33472215). Plays a key role in the induction of plasma membrane rupture during programmed and necrotic cell death: oligomerizes in response to death stimuli to mediate plasma membrane rupture (cytolysis), leading to release intracellular molecules named damage-associated molecular patterns (DAMPs) that propagate the inflammatory response (PubMed:33472215). Plays a role in nerve regeneration by promoting maturation of Schwann cells (PubMed:31526566). Acts as a regulator of angiogenesis (PubMed:25766274, PubMed:30354207). Promotes the formation of new vessels by mediating the interaction between capillary pericyte cells and endothelial cells (PubMed:25766274, PubMed:30354207). Also mediates vascular functions in penile tissue as well as vascular formation (PubMed:24979788). Promotes osteoclasts development by enhancing the survival of prefusion osteoclasts (PubMed:30700695). Also involved in striated muscle growth and differentiation (PubMed:31091274). Also involved in cell senescence in a p53/TP53 manner, possibly by acting as an indirect regulator of p53/TP53 mRNA translation (PubMed:23690620, PubMed:29073078). {ECO:0000250|UniProtKB:Q92982, ECO:0000269|PubMed:19557008, ECO:0000269|PubMed:23690620, ECO:0000269|PubMed:24347169, ECO:0000269|PubMed:24917672, ECO:0000269|PubMed:24979788, ECO:0000269|PubMed:25766274, ECO:0000269|PubMed:25860173, ECO:0000269|PubMed:29073078, ECO:0000269|PubMed:30354207, ECO:0000269|PubMed:30510259, ECO:0000269|PubMed:30700695, ECO:0000269|PubMed:31091274, ECO:0000269|PubMed:31526566, ECO:0000269|PubMed:33472215}.; FUNCTION: [Secreted ninjurin-1]: Secreted form generated by cleavage, which has chemotactic activity (PubMed:23142597). Acts as an anti-inflammatory mediator by promoting monocyte recruitment, thereby ameliorating atherosclerosis (PubMed:32883094). {ECO:0000269|PubMed:23142597, ECO:0000269|PubMed:32883094}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (2); Glycosylation (1); Modified residue (3); Mutagenesis (2); Region (3); Site (1); Topological domain (3); Transmembrane (2) |
| Keywords | Acetylation;Angiogenesis;Behavior;Cell adhesion;Cell junction;Cell membrane;Cytolysis;Glycoprotein;Inflammatory response;Membrane;Phosphoprotein;Reference proteome;Secreted;Synapse;Transmembrane;Transmembrane helix |
| Interact With | |
| Induction | INDUCTION: By nerve injury (PubMed:9465296). Expression is activated by p53/TP53 (PubMed:23690620). {ECO:0000269|PubMed:23690620, ECO:0000269|PubMed:9465296}. |
| Subcellular Location | SUBCELLULAR LOCATION: [Ninjurin-1]: Cell membrane {ECO:0000269|PubMed:24917672, ECO:0000269|PubMed:27815839, ECO:0000269|PubMed:31091274, ECO:0000269|PubMed:33472215}; Multi-pass membrane protein {ECO:0000255}. Cell junction, synapse, synaptic cell membrane {ECO:0000269|PubMed:27815839}; Multi-pass membrane protein {ECO:0000255}.; SUBCELLULAR LOCATION: [Secreted ninjurin-1]: Secreted {ECO:0000269|PubMed:23142597, ECO:0000269|PubMed:32883094}. |
| Modified Residue | MOD_RES 1; /note=N-acetylmethionine; /evidence=ECO:0000250|UniProtKB:Q92982; MOD_RES 18; /note=Phosphoserine; /evidence=ECO:0000250|UniProtKB:P70617; MOD_RES 21; /note=Phosphoserine; /evidence=ECO:0000250|UniProtKB:P70617 |
| Post Translational Modification | PTM: [Ninjurin-1]: Cleaved by MMP9 protease to generate the Secreted ninjurin-1 form. {ECO:0000269|PubMed:23142597, ECO:0000269|PubMed:32883094}.; PTM: [Ninjurin-1]: N-linked glycosylation is required for homooligomerization. {ECO:0000269|PubMed:28067406}. |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 10725249; 12466851; 16141072; 19449303; 21267068; 21677750; 23551591; 26275310; 27127177; 31963519; 33961504; |
| Motif | |
| Gene Encoded By | |
| Mass | 16,555 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |