Detail Information for IndEnz0002007955
IED ID IndEnz0002007955
Enzyme Type ID protease007955
Protein Name Major prion protein
PrP
Major scrapie-associated fibril protein 1
CD antigen CD230
Gene Name PRNP PRP
Organism Bos taurus (Bovine)
Taxonomic Lineage cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Laurasiatheria Artiodactyla Ruminantia Pecora Bovidae Bovinae Bos (oxen cattle) Bos taurus (Bovine)
Enzyme Sequence MVKSHIGSWILVLFVAMWSDVGLCKKRPKPGGGWNTGGSRYPGQGSPGGNRYPPQGGGGWGQPHGGGWGQPHGGGWGQPHGGGWGQPHGGGWGQPHGGGGWGQGGTHGQWNKPSKPKTNMKHVAGAAAAGAVVGGLGGYMLGSAMSRPLIHFGSDYEDRYYRENMHRYPNQVYYRPVDQYSNQNNFVHDCVNITVKEHTVTTTTKGENFTETDIKMMERVVEQMCITQYQRESQAYYQRGASVILFSSPPVILLISFLIFLIVG
Enzyme Length 264
Uniprot Accession Number P10279
Absorption
Active Site
Activity Regulation
Binding Site
Calcium Binding
catalytic Activity
DNA Binding
EC Number
Enzyme Function FUNCTION: Its primary physiological function is unclear. May play a role in neuronal development and synaptic plasticity. May be required for neuronal myelin sheath maintenance. May promote myelin homeostasis through acting as an agonist for ADGRG6 receptor. May play a role in iron uptake and iron homeostasis. Soluble oligomers are toxic to cultured neuroblastoma cells and induce apoptosis (in vitro) (By similarity). Association with GPC1 (via its heparan sulfate chains) targets PRNP to lipid rafts. Also provides Cu(2+) or Zn(2+) for the ascorbate-mediated GPC1 deaminase degradation of its heparan sulfate side chains (By similarity). {ECO:0000250|UniProtKB:P04156, ECO:0000250|UniProtKB:P04925}.
Temperature Dependency
PH Dependency
Pathway
nucleotide Binding
Features Beta strand (4); Chain (1); Disulfide bond (1); Glycosylation (2); Helix (7); Lipidation (1); Metal binding (12); Natural variant (9); Propeptide (1); Region (4); Repeat (6); Sequence conflict (3); Signal peptide (1); Turn (1)
Keywords 3D-structure;Amyloid;Cell membrane;Copper;Direct protein sequencing;Disulfide bond;GPI-anchor;Glycoprotein;Golgi apparatus;Lipoprotein;Membrane;Metal-binding;Prion;Reference proteome;Repeat;Signal;Zinc
Interact With Itself; P04156
Induction
Subcellular Location SUBCELLULAR LOCATION: Cell membrane {ECO:0000250|UniProtKB:P04156}; Lipid-anchor, GPI-anchor {ECO:0000250|UniProtKB:P04156}. Golgi apparatus {ECO:0000250|UniProtKB:P04925}. Note=Targeted to lipid rafts via association with the heparan sulfate chains of GPC1. Colocates, in the presence of Cu(2+), to vesicles in para- and perinuclear regions, where both proteins undergo internalization. Heparin displaces PRNP from lipid rafts and promotes endocytosis. {ECO:0000250|UniProtKB:P04156}.
Modified Residue
Post Translational Modification
Signal Peptide SIGNAL 1..24; /evidence=ECO:0000269|PubMed:2904126
Structure 3D NMR spectroscopy (7); X-ray crystallography (2)
Cross Reference PDB 1DWY; 1DWZ; 1DX0; 1DX1; 1SKH; 2HH0; 2RSK; 2RU7; 4YX2;
Mapped Pubmed ID 12389035; 12902353; 14727152; 14999066; 15208260; 16141216; 16198347; 16774738; 16965405; 16978176; 17014722; 17079295; 17092337; 17165097; 17272863; 17283444; 17426768; 17437640; 17595008; 17605301; 17709775; 17981143; 17981146; 18064562; 18505676; 19008948; 19098441; 19283723; 19507705; 19607920; 19821149; 19917050; 20140032; 20380155; 20434583; 20553871; 20862290; 21120616; 21611160; 21800884; 21920025; 21943430; 22138399; 22170597; 22258312; 22285492; 22412936; 22453183; 22634099; 22674901; 22723200; 22781833; 23180780; 24803670; 24970211; 26157118; 26320075; 27224046; 27606840; 29262866; 30555062; 31511544;
Motif
Gene Encoded By
Mass 28,614
Kinetics
Metal Binding METAL 72; /note=Cu(2+) 1; /evidence=ECO:0000250|UniProtKB:P04156; METAL 73; /note=Cu(2+) 1; via amide nitrogen; /evidence=ECO:0000250|UniProtKB:P04156; METAL 74; /note=Cu(2+) 1; via amide nitrogen and carbonyl oxygen; /evidence=ECO:0000250|UniProtKB:P04156; METAL 80; /note=Cu(2+) 2; /evidence=ECO:0000250|UniProtKB:P04156; METAL 81; /note=Cu(2+) 2; via amide nitrogen; /evidence=ECO:0000250|UniProtKB:P04156; METAL 82; /note=Cu(2+) 2; via amide nitrogen and carbonyl oxygen; /evidence=ECO:0000250|UniProtKB:P04156; METAL 88; /note=Cu(2+) 3; /evidence=ECO:0000250|UniProtKB:P04156; METAL 89; /note=Cu(2+) 3; via amide nitrogen; /evidence=ECO:0000250|UniProtKB:P04156; METAL 90; /note=Cu(2+) 3; via amide nitrogen and carbonyl oxygen; /evidence=ECO:0000250|UniProtKB:P04156; METAL 96; /note=Cu(2+) 4; /evidence=ECO:0000250|UniProtKB:P04156; METAL 98; /note=Cu(2+) 4; via amide nitrogen; /evidence=ECO:0000250|UniProtKB:P04156; METAL 99; /note=Cu(2+) 4; via amide nitrogen and carbonyl oxygen; /evidence=ECO:0000250|UniProtKB:P04156
Rhea ID
Cross Reference Brenda