| IED ID | IndEnz0002007961 |
| Enzyme Type ID | protease007961 |
| Protein Name |
Portal protein Gene product 29 gp29 Gene product H gpH Head-tail connector |
| Gene Name | H Mup29 |
| Organism | Escherichia phage Mu (Bacteriophage Mu) |
| Taxonomic Lineage | Viruses Duplodnaviria Heunggongvirae Uroviricota Caudoviricetes Caudovirales Myoviridae (phages with contractile tails) Muvirus Escherichia phage Mu (Bacteriophage Mu) |
| Enzyme Sequence | MGRILDISGQPFDFDDEMQSRSDELAMVMKRTQEHPSSGVTPNRAAQMLRDAERGDLTAQADLAFDMEEKDTHLFSELSKRRLAIQALEWRIAPARDASAQEKKDADMLNEYLHDAAWFEDALFDAGDAILKGYSMQEIEWGWLGKMRVPVALHHRDPALFCANPDNLNELRLRDASYHGLELQPFGWFMHRAKSRTGYVGTNGLVRTLIWPFIFKNYSVRDFAEFLEIYGLPMRVGKYPTGSTNREKATLMQAVMDIGRRAGGIIPMGMTLDFQSAADGQSDPFMAMIGWAEKAISKAILGGTLTTEAGDKGARSLGEVHDEVRREIRNADVGQLARSINRDLIYPLLALNSDSTIDINRLPGIVFDTSEAGDITALSDAIPKLAAGMRIPVSWIQEKLHIPQPVGDEAVFTIQPVVPDNGSQKEAALSAEDIPQEDDIDRMGVSPEDWQRSVDPLLKPVIFSVLKDGPEAAMNKAASLYPQMDDAELIDMLTRAIFVADIWGRLDAAADH |
| Enzyme Length | 512 |
| Uniprot Accession Number | Q9T1W5 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Forms the portal vertex of the capsid. This portal plays critical roles in head assembly, genome packaging, neck/tail attachment, and genome ejection. The portal protein multimerizes as a single ring-shaped homododecamer arranged around a central channel. Binds to the terminase subunits to form the packaging machine. Acts as a linker between the capsid and tail. Required for attachment of the neck proteins to the capsid. {ECO:0000305|PubMed:11922669, ECO:0000305|PubMed:8599204, ECO:0000305|PubMed:9495752}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1) |
| Keywords | Capsid protein;Host cytoplasm;Late protein;Reference proteome;Viral capsid assembly;Viral contractile tail ejection system;Viral genome ejection through host cell envelope;Viral genome packaging;Viral penetration into host cytoplasm;Viral release from host cell;Virion;Virus entry into host cell |
| Interact With | |
| Induction | INDUCTION: Expressed in the late phase of the viral replicative cycle. Expression of late genes is activated by the viral late transcription activator C. {ECO:0000269|PubMed:8293968}. |
| Subcellular Location | SUBCELLULAR LOCATION: Virion {ECO:0000269|PubMed:8599204}. Host cytoplasm {ECO:0000305|PubMed:8599204}. Note=Located at a unique 5-fold vertex of the icosahedral capsid. |
| Modified Residue | |
| Post Translational Modification | PTM: Cleavage by the viral I protease yields a C-terminally cleaved portal protein competent for DNA packaging and procpasid maturation. {ECO:0000269|PubMed:8599204}. |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 56,888 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |