| IED ID | IndEnz0002008020 |
| Enzyme Type ID | protease008020 |
| Protein Name |
Kazal peptide Pr13a Venom Kazal domain peptide Pr13a |
| Gene Name | |
| Organism | Platymeris rhadamanthus (Red spot assassin bug) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Protostomia Ecdysozoa Panarthropoda Arthropoda Mandibulata Pancrustacea Hexapoda Insecta Dicondylia Pterygota (winged insects) Neoptera Paraneoptera Hemiptera Prosorrhyncha (bugs) Heteroptera (true bugs) Euheteroptera Neoheteroptera Panheteroptera Cimicomorpha Reduvioidea Reduviidae (assassin bugs) Reduviidae incertae sedis Platymeris Platymeris rhadamanthus (Red spot assassin bug) |
| Enzyme Sequence | MKYIILFLVLIGLQANLALGSKCKCDCTKYPYSPVCAKELKTGDTETFNNVCQLQCYNCTHMKNYVVIYSGSC |
| Enzyme Length | 73 |
| Uniprot Accession Number | A0A6B9L1F0 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: May act as a serine protease inhibitor, since it possess the kazal serine protease inhibitor signature. {ECO:0000305}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (3); Domain (1); Signal peptide (1); Site (1) |
| Keywords | Disulfide bond;Protease inhibitor;Secreted;Serine protease inhibitor;Signal |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000305|PubMed:31752210}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..20; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 8,200 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |