IED ID | IndEnz0002008059 |
Enzyme Type ID | protease008059 |
Protein Name |
Aspergillopepsin-2 EC 3.4.23.19 Acid protease A Aspergillopepsin II Proctase A Cleaved into: Aspergillopepsin-2 light chain Aspergillopepsin II light chain ; Aspergillopepsin-2 heavy chain Aspergillopepsin II heavy chain |
Gene Name | |
Organism | Aspergillus niger |
Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Fungi Dikarya Ascomycota saccharomyceta Pezizomycotina leotiomyceta Eurotiomycetes Eurotiomycetidae Eurotiales (green and blue molds) Aspergillaceae Aspergillus Aspergillus subgen. Circumdati Aspergillus niger |
Enzyme Sequence | MKFSTILTGSLFATAALAAPLTEKRRARKEARAAGKRHSNPPYIPGSDKEILKLNGTTNEEYSSNWAGAVLIGDGYTKVTGEFTVPSVSAGSSGSSGYGGGYGYWKNKRQSEEYCASAWVGIDGDTCETAILQTGVDFCYEDGQTSYDAWYEWYPDYAYDFSDITISEGDSIKVTVEATSKSSGSATVENLTTGQSVTHTFSGNVEGDLCETNAEWIVEDFESGDSLVAFADFGSVTFTNAEATSGGSTVGPSDATVMDIEQDGSVLTETSVSGDSVTVTYV |
Enzyme Length | 282 |
Uniprot Accession Number | P24665 |
Absorption | |
Active Site | |
Activity Regulation | |
Binding Site | |
Calcium Binding | |
catalytic Activity | CATALYTIC ACTIVITY: Reaction=Preferential cleavage in B chain of insulin: 3-Asn-|-Gln-4, 13-Gly-|-Ala-14, and 26-Tyr-|-Thr-27.; EC=3.4.23.19; |
DNA Binding | |
EC Number | 3.4.23.19 |
Enzyme Function | |
Temperature Dependency | |
PH Dependency | |
Pathway | |
nucleotide Binding | |
Features | Beta strand (17); Chain (2); Disulfide bond (2); Helix (1); Modified residue (1); Propeptide (2); Region (1); Signal peptide (1); Turn (1) |
Keywords | 3D-structure;Aspartyl protease;Cleavage on pair of basic residues;Direct protein sequencing;Disulfide bond;Hydrolase;Protease;Pyrrolidone carboxylic acid;Signal;Zymogen |
Interact With | |
Induction | |
Subcellular Location | |
Modified Residue | MOD_RES 110; /note=Pyrrolidone carboxylic acid; /evidence=ECO:0000269|PubMed:1918059 |
Post Translational Modification | |
Signal Peptide | SIGNAL 1..18; /evidence=ECO:0000255 |
Structure 3D | X-ray crystallography (2) |
Cross Reference PDB | 1Y43; 3TRS; |
Mapped Pubmed ID | 22569035; |
Motif | |
Gene Encoded By | |
Mass | 29,887 |
Kinetics | |
Metal Binding | |
Rhea ID | |
Cross Reference Brenda |