| IED ID | IndEnz0002008072 |
| Enzyme Type ID | protease008072 |
| Protein Name |
Mitochondrial inner membrane protease ATP23 EC 3.4.24.- |
| Gene Name | ATP23 CNE03410 |
| Organism | Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) (Filobasidiella neoformans) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Fungi Dikarya Basidiomycota Agaricomycotina Tremellomycetes Tremellales (jelly fungi) Cryptococcaceae Cryptococcus Cryptococcus neoformans species complex Cryptococcus neoformans (Filobasidiella neoformans) Cryptococcus neoformans var. neoformans Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) (Filobasidiella neoformans) |
| Enzyme Sequence | MPENPSSSPTEPPEQSAAFEKWRSGLAQFTGLGLSESEKAERERLKAQGKLAKDWDKCEGWKRDLMNYSPMITFLLNHLKLAGCPFPSSAMQCHPCPENRAGGFSPDHGILLCQDRFFNKKHMEDTLAHELVHAFDHCRFKVDWGNLRHHACSEIRAANLSGDCRFTREVKRGFYAFNKQHQACVKRRAILSVLANPACTSPEMAEKAVNEVWESCFTDTRPFDEIY |
| Enzyme Length | 227 |
| Uniprot Accession Number | P0CQ26 |
| Absorption | |
| Active Site | ACT_SITE 130; /evidence=ECO:0000255|PROSITE-ProRule:PRU10095 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.4.24.- |
| Enzyme Function | FUNCTION: Has a dual role in the assembly of mitochondrial ATPase. Acts as a protease that removes N-terminal residues of mitochondrial ATPase CF(0) subunit 6 at the intermembrane space side. Also involved in the correct assembly of the membrane-embedded ATPase CF(0) particle, probably mediating association of subunit 6 with the subunit 9 ring (By similarity). {ECO:0000250}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (1); Chain (1); Metal binding (2) |
| Keywords | Hydrolase;Membrane;Metal-binding;Metalloprotease;Mitochondrion;Mitochondrion inner membrane;Protease;Reference proteome |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Mitochondrion inner membrane; Peripheral membrane protein; Intermembrane side. Note=Associates loosely with the inner membrane. {ECO:0000250}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 25,850 |
| Kinetics | |
| Metal Binding | METAL 129; /note=Divalent metal cation; catalytic; /evidence=ECO:0000250; METAL 133; /note=Divalent metal cation; catalytic; /evidence=ECO:0000250 |
| Rhea ID | |
| Cross Reference Brenda |