| IED ID | IndEnz0002008090 |
| Enzyme Type ID | protease008090 |
| Protein Name |
Macrophage migration inhibitory factor MIF EC 5.3.2.1 L-dopachrome isomerase L-dopachrome tautomerase EC 5.3.3.12 Phenylpyruvate tautomerase |
| Gene Name | MIF QccE-19130 |
| Organism | Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Primates Haplorrhini Simiiformes Catarrhini Cercopithecoidea Cercopithecidae (Old World monkeys) Cercopithecinae Macaca (macaques) Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey) |
| Enzyme Sequence | MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA |
| Enzyme Length | 115 |
| Uniprot Accession Number | Q4R549 |
| Absorption | |
| Active Site | ACT_SITE 2; /note=Proton acceptor; via imino nitrogen; /evidence=ECO:0000250 |
| Activity Regulation | |
| Binding Site | BINDING 33; /note=Substrate; /evidence=ECO:0000250; BINDING 65; /note=Substrate; via amide nitrogen; /evidence=ECO:0000250; BINDING 98; /note=Substrate; /evidence=ECO:0000250 |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=3-phenylpyruvate = enol-phenylpyruvate; Xref=Rhea:RHEA:17097, ChEBI:CHEBI:16815, ChEBI:CHEBI:18005; EC=5.3.2.1; CATALYTIC ACTIVITY: Reaction=L-dopachrome = 5,6-dihydroxyindole-2-carboxylate; Xref=Rhea:RHEA:13041, ChEBI:CHEBI:16875, ChEBI:CHEBI:57509; EC=5.3.3.12; |
| DNA Binding | |
| EC Number | 5.3.2.1; 5.3.3.12 |
| Enzyme Function | FUNCTION: Pro-inflammatory cytokine. Involved in the innate immune response to bacterial pathogens. The expression of MIF at sites of inflammation suggests a role as mediator in regulating the function of macrophages in host defense. Counteracts the anti-inflammatory activity of glucocorticoids. Has phenylpyruvate tautomerase and dopachrome tautomerase activity (in vitro), but the physiological substrate is not known. It is not clear whether the tautomerase activity has any physiological relevance, and whether it is important for cytokine activity (By similarity). {ECO:0000250|UniProtKB:P14174}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (1); Binding site (3); Chain (1); Modified residue (2) |
| Keywords | Acetylation;Cytokine;Cytoplasm;Immunity;Inflammatory response;Innate immunity;Isomerase;Reference proteome;Secreted |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000250|UniProtKB:P14174}. Cytoplasm {ECO:0000250|UniProtKB:P14174}. Note=Does not have a cleavable signal sequence and is secreted via a specialized, non-classical pathway. Secreted by macrophages upon stimulation by bacterial lipopolysaccharide (LPS), or by M.tuberculosis antigens (By similarity). {ECO:0000250|UniProtKB:P14174}. |
| Modified Residue | MOD_RES 78; /note=N6-acetyllysine; alternate; /evidence=ECO:0000250|UniProtKB:P14174; MOD_RES 78; /note=N6-succinyllysine; alternate; /evidence=ECO:0000250|UniProtKB:P34884 |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 12,476 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | RHEA:17097; RHEA:13041 |
| Cross Reference Brenda |