IED ID |
IndEnz0002008155 |
Enzyme Type ID |
protease008155 |
Protein Name |
ABC transporter guanosine-binding protein NupN
|
Gene Name |
nupN yufN BSU31540 |
Organism |
Bacillus subtilis (strain 168) |
Taxonomic Lineage |
cellular organisms
Bacteria
Terrabacteria group
Firmicutes
Bacilli
Bacillales
Bacillaceae
Bacillus
Bacillus subtilis group
Bacillus subtilis
Bacillus subtilis subsp. subtilis
Bacillus subtilis (strain 168)
|
Enzyme Sequence |
MNKRKIGLAMSLVIAAGTILGACGNSEKSSGSGEGKNKFSVAMVTDVGGVDDKSFNQSAWEGIQAFGKENGLKKGKNGYDYLQSKSDADYTTNLNKLARENFDLIYGVGYLMEDSISEIADQRKNTNFAIIDAVVDKDNVASITFKEQEGSFLVGVAAALSSKSGKIGFVGGMESELIKKFEVGFRAGVQAVNPKAVVEVKYAGGFDKADVGKATAESMYKSGVDVIYHSAGATGTGVFTEAKNLKKEDPKRDVWVIGVDKDQYAEGQVEGTDDNVTLTSMVKKVDTVVEDVTKKASDGKFPGGETLTYGLDQDGVGISPSKQNLSDDVIKAVDKWKKKIIDGLEIPATEKELKTFKAE |
Enzyme Length |
359 |
Uniprot Accession Number |
O05252 |
Absorption |
|
Active Site |
|
Activity Regulation |
|
Binding Site |
|
Calcium Binding |
|
catalytic Activity |
|
DNA Binding |
|
EC Number |
|
Enzyme Function |
FUNCTION: Part of an ABC transporter complex involved in the uptake of guanosine (PubMed:21926227). Is probably the substrate-binding protein of the system (PubMed:21926227). May be a nucleoside transporter of broad specificity but with various affinities for different substrates (PubMed:21926227). {ECO:0000269|PubMed:21926227}. |
Temperature Dependency |
|
PH Dependency |
|
Pathway |
|
nucleotide Binding |
|
Features |
Chain (1); Erroneous initiation (1); Lipidation (2); Signal peptide (1) |
Keywords |
Cell membrane;Lipoprotein;Membrane;Palmitate;Reference proteome;Signal |
Interact With |
|
Induction |
INDUCTION: Transcriptionally regulated by CodY. {ECO:0000269|PubMed:21926227}. |
Subcellular Location |
SUBCELLULAR LOCATION: Cell membrane {ECO:0000255|PROSITE-ProRule:PRU00303, ECO:0000269|PubMed:22882210}; Lipid-anchor {ECO:0000255|PROSITE-ProRule:PRU00303}. Membrane raft {ECO:0000269|PubMed:22882210}. Note=Present in detergent-resistant membrane (DRM) fractions that may be equivalent to eukaryotic membrane rafts; these rafts include proteins involved in signaling, molecule trafficking and protein secretion. {ECO:0000269|PubMed:22882210}. |
Modified Residue |
|
Post Translational Modification |
|
Signal Peptide |
SIGNAL 1..22; /evidence=ECO:0000255|PROSITE-ProRule:PRU00303 |
Structure 3D |
|
Cross Reference PDB |
- |
Mapped Pubmed ID |
- |
Motif |
|
Gene Encoded By |
|
Mass |
38,361 |
Kinetics |
|
Metal Binding |
|
Rhea ID |
|
Cross Reference Brenda |
|