| IED ID |
IndEnz0002008155 |
| Enzyme Type ID |
protease008155 |
| Protein Name |
ABC transporter guanosine-binding protein NupN
|
| Gene Name |
nupN yufN BSU31540 |
| Organism |
Bacillus subtilis (strain 168) |
| Taxonomic Lineage |
cellular organisms
Bacteria
Terrabacteria group
Firmicutes
Bacilli
Bacillales
Bacillaceae
Bacillus
Bacillus subtilis group
Bacillus subtilis
Bacillus subtilis subsp. subtilis
Bacillus subtilis (strain 168)
|
| Enzyme Sequence |
MNKRKIGLAMSLVIAAGTILGACGNSEKSSGSGEGKNKFSVAMVTDVGGVDDKSFNQSAWEGIQAFGKENGLKKGKNGYDYLQSKSDADYTTNLNKLARENFDLIYGVGYLMEDSISEIADQRKNTNFAIIDAVVDKDNVASITFKEQEGSFLVGVAAALSSKSGKIGFVGGMESELIKKFEVGFRAGVQAVNPKAVVEVKYAGGFDKADVGKATAESMYKSGVDVIYHSAGATGTGVFTEAKNLKKEDPKRDVWVIGVDKDQYAEGQVEGTDDNVTLTSMVKKVDTVVEDVTKKASDGKFPGGETLTYGLDQDGVGISPSKQNLSDDVIKAVDKWKKKIIDGLEIPATEKELKTFKAE |
| Enzyme Length |
359 |
| Uniprot Accession Number |
O05252 |
| Absorption |
|
| Active Site |
|
| Activity Regulation |
|
| Binding Site |
|
| Calcium Binding |
|
| catalytic Activity |
|
| DNA Binding |
|
| EC Number |
|
| Enzyme Function |
FUNCTION: Part of an ABC transporter complex involved in the uptake of guanosine (PubMed:21926227). Is probably the substrate-binding protein of the system (PubMed:21926227). May be a nucleoside transporter of broad specificity but with various affinities for different substrates (PubMed:21926227). {ECO:0000269|PubMed:21926227}. |
| Temperature Dependency |
|
| PH Dependency |
|
| Pathway |
|
| nucleotide Binding |
|
| Features |
Chain (1); Erroneous initiation (1); Lipidation (2); Signal peptide (1) |
| Keywords |
Cell membrane;Lipoprotein;Membrane;Palmitate;Reference proteome;Signal |
| Interact With |
|
| Induction |
INDUCTION: Transcriptionally regulated by CodY. {ECO:0000269|PubMed:21926227}. |
| Subcellular Location |
SUBCELLULAR LOCATION: Cell membrane {ECO:0000255|PROSITE-ProRule:PRU00303, ECO:0000269|PubMed:22882210}; Lipid-anchor {ECO:0000255|PROSITE-ProRule:PRU00303}. Membrane raft {ECO:0000269|PubMed:22882210}. Note=Present in detergent-resistant membrane (DRM) fractions that may be equivalent to eukaryotic membrane rafts; these rafts include proteins involved in signaling, molecule trafficking and protein secretion. {ECO:0000269|PubMed:22882210}. |
| Modified Residue |
|
| Post Translational Modification |
|
| Signal Peptide |
SIGNAL 1..22; /evidence=ECO:0000255|PROSITE-ProRule:PRU00303 |
| Structure 3D |
|
| Cross Reference PDB |
- |
| Mapped Pubmed ID |
- |
| Motif |
|
| Gene Encoded By |
|
| Mass |
38,361 |
| Kinetics |
|
| Metal Binding |
|
| Rhea ID |
|
| Cross Reference Brenda |
|