IED ID | IndEnz0002008158 |
Enzyme Type ID | protease008158 |
Protein Name |
Proteasome subunit beta type-6-B like protein EC 3.4.25.1 Low molecular mass protein 2-delta-B |
Gene Name | psmb6l-b lmp2-delta-b |
Organism | Salmo salar (Atlantic salmon) |
Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Actinopterygii Actinopteri Neopterygii Teleostei Osteoglossocephalai Clupeocephala Euteleosteomorpha Protacanthopterygii Salmoniformes (salmons and trouts) Salmonidae (salmonids) Salmoninae (trouts salmons & chars) Salmo Salmo salar (Atlantic salmon) |
Enzyme Sequence | MERHFMDSQIKGVSTGTTILAVTFNGGVIIGSDSRASIGGSYVSSKTINKLIQVHDRIFCCIAGSLADAQAVTKAAKFQISFHSIQMESPPLVKAAASVLKELCYNNKEELQAGFITAGWDRKKGPQVYTVALGGMLLSQPFTIGGSGSTYIYGYADAKYKPDMSKEECLQFATNALALAMGRDNVSGGVAHLVVITEEGVEHVVIPGDKLPKFHDE |
Enzyme Length | 217 |
Uniprot Accession Number | A7KII6 |
Absorption | |
Active Site | ACT_SITE 17; /note=Nucleophile; /evidence=ECO:0000250 |
Activity Regulation | |
Binding Site | |
Calcium Binding | |
catalytic Activity | CATALYTIC ACTIVITY: Reaction=Cleavage of peptide bonds with very broad specificity.; EC=3.4.25.1; |
DNA Binding | |
EC Number | 3.4.25.1 |
Enzyme Function | FUNCTION: The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity. This subunit is involved in antigen processing to generate class I binding peptides (By similarity). {ECO:0000250}. |
Temperature Dependency | |
PH Dependency | |
Pathway | |
nucleotide Binding | |
Features | Active site (1); Chain (1); Propeptide (1) |
Keywords | Cytoplasm;Hydrolase;Immunity;Nucleus;Protease;Proteasome;Reference proteome;Threonine protease;Zymogen |
Interact With | |
Induction | |
Subcellular Location | SUBCELLULAR LOCATION: Cytoplasm {ECO:0000255|PROSITE-ProRule:PRU00809}. Nucleus {ECO:0000250}. |
Modified Residue | |
Post Translational Modification | |
Signal Peptide | |
Structure 3D | |
Cross Reference PDB | - |
Mapped Pubmed ID | - |
Motif | |
Gene Encoded By | |
Mass | 23,208 |
Kinetics | |
Metal Binding | |
Rhea ID | |
Cross Reference Brenda |