| IED ID | IndEnz0002008195 |
| Enzyme Type ID | protease008195 |
| Protein Name |
Pol polyprotein Fragment |
| Gene Name | pol |
| Organism | Simian immunodeficiency virus agm.vervet (isolate AGM266) (SIV-agm.ver) (Simian immunodeficiency virus African green monkey vervet) |
| Taxonomic Lineage | Viruses Riboviria Pararnavirae Artverviricota Revtraviricetes Ortervirales Retroviridae Orthoretrovirinae Lentivirus Simian immunodeficiency virus (SIV) Simian immunodeficiency virus - agm Simian immunodeficiency virus - agm.ver Simian immunodeficiency virus agm.vervet (isolate AGM266) (SIV-agm.ver) (Simian immunodeficiency virus African green monkey vervet) |
| Enzyme Sequence | AGLLAGSWIPDWTFVSVPPLVTLWYTLTKEPIPGEDVYYVDGACNRNSREGKAGYITQQGKQRVEKLENTTNQQAELTAIKMALEDSGPRVNIVTDSQYA |
| Enzyme Length | 100 |
| Uniprot Accession Number | P12500 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: During replicative cycle of retroviruses, the reverse-transcribed viral DNA is integrated into the host chromosome by the viral integrase enzyme. RNase H activity is associated with the reverse transcriptase. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Domain (1); Non-terminal residue (2) |
| Keywords | Aspartyl protease;DNA integration;DNA recombination;Endonuclease;Eukaryotic host gene expression shutoff by virus;Eukaryotic host translation shutoff by virus;Host gene expression shutoff by virus;Host-virus interaction;Hydrolase;Multifunctional enzyme;Nuclease;Nucleotidyltransferase;Protease;RNA-directed DNA polymerase;Transferase |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 11,075 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |