| IED ID | IndEnz0002008222 |
| Enzyme Type ID | protease008222 |
| Protein Name |
Outer capsid protein sigma-3 Sigma3 |
| Gene Name | S4 |
| Organism | Reovirus type 3 (strain Dearing) (T3D) (Mammalian orthoreovirus 3) |
| Taxonomic Lineage | Viruses Riboviria Orthornavirae Duplornaviricota Resentoviricetes Reovirales Reoviridae Spinareovirinae Orthoreovirus Mammalian orthoreovirus Mammalian orthoreovirus 3 Reovirus type 3 (strain Dearing) (T3D) (Mammalian orthoreovirus 3) |
| Enzyme Sequence | MEVCLPNGHQVVDLINNAFEGRVSIYSAQEGWDKTISAQPDMMVCGGAVVCMHCLGVVGSLQRKLKHLPHHRCNQQIRHQDYVDVQFADRVTAHWKRGMLSFVAQMHEMMNDVSPDDLDRVRTEGGSLVELNWLQVDPNSMFRSIHSSWTDPLQVVDDLDTKLDQYWTALNLMIDSSDLIPNFMMRDPSHAFNGVKLGGDARQTQFSRTFDSRSSLEWGVMVYDYSELEHDPSKGRAYRKELVTPARDFGHFGLSHYSRATTPILGKMPAVFSGMLTGNCKMYPFIKGTAKLKTVRKLVEAVNHAWGVEKIRYALGPGGMTGWYNRTMQQAPIVLTPAALTMFPDTIKFGDLNYPVMIGDPMILG |
| Enzyme Length | 365 |
| Uniprot Accession Number | P03527 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Stimulates translation by blocking the activation of the dsRNA-dependent protein kinase EIF2AK2/PKR, thereby inhibiting the host interferon response. Sigma3 prevents the activation of EIF2AK2 by competing with the kinase for dsRNA-binding. {ECO:0000269|PubMed:9268168}.; FUNCTION: The viral outer shell polypeptides, of which sigma-3 is one, impose structural constraints that prevent elongation of nascent transcripts by the RNA-dependent RNA polymerase lambda-3. {ECO:0000250}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Beta strand (13); Chain (1); Helix (20); Natural variant (1); Sequence conflict (2); Turn (4); Zinc finger (1) |
| Keywords | 3D-structure;Capsid protein;Host-virus interaction;Inhibition of host PKR by virus;Inhibition of host innate immune response by virus;Inhibition of host interferon signaling pathway by virus;Interferon antiviral system evasion;Metal-binding;Outer capsid protein;RNA-binding;Reference proteome;Transcription;Transcription regulation;Translation regulation;Viral immunoevasion;Virion;Zinc;Zinc-finger |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Virion. Note=Found in the outer capsid. Each subunit is positioned with the small lobe anchoring it to the protein mu1 on the surface of the virion, and the large lobe, the site of initial cleavages during entry-related proteolytic disassembly, protruding outwards. |
| Modified Residue | |
| Post Translational Modification | PTM: Cleaved during virus the endosomal proteolytic disassembly of the outer capsid. |
| Signal Peptide | |
| Structure 3D | Electron microscopy (1); X-ray crystallography (1) |
| Cross Reference PDB | 1FN9; 7LUP; |
| Mapped Pubmed ID | 33836586; |
| Motif | |
| Gene Encoded By | |
| Mass | 41,118 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |