| IED ID | IndEnz0002008242 |
| Enzyme Type ID | protease008242 |
| Protein Name |
Serine protease inhibitor I/II Cleaved into: Protease inhibitor SGPI-1 Schistocerca gregaria trypsin inhibitor SGTI ; Protease inhibitor SGPI-2 Schistocerca gregaria chymotrypsin inhibitor SGCI |
| Gene Name | |
| Organism | Schistocerca gregaria (Desert locust) (Gryllus gregarius) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Protostomia Ecdysozoa Panarthropoda Arthropoda Mandibulata Pancrustacea Hexapoda Insecta Dicondylia Pterygota (winged insects) Neoptera Polyneoptera Orthoptera Caelifera (grasshoppers and locusts) Acrididea Acridomorpha Acridoidea Acrididae (short-horned grasshoppers) Cyrtacanthacridinae (migratory bird locusts) Schistocerca Schistocerca gregaria (Desert locust) (Gryllus gregarius) |
| Enzyme Sequence | MKLALALCAAFLLVVLVQAEQECTPGQTKKQDCNTCNCTPTGVWACTRKGCPPHKREVTCEPGTTFKDKCNTCRCGSDGKSAACTLKACPQK |
| Enzyme Length | 92 |
| Uniprot Accession Number | O46162 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: [Protease inhibitor SGPI-1]: In vitro, is active against alpha-chymotrypsin and trypsin. {ECO:0000269|PubMed:9475173}.; FUNCTION: [Protease inhibitor SGPI-2]: In vitro, is active against alpha-chymotrypsin and pancreatic elastase. {ECO:0000269|PubMed:9475173}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Beta strand (7); Disulfide bond (6); Domain (2); Peptide (2); Signal peptide (1); Site (2); Turn (1) |
| Keywords | 3D-structure;Cleavage on pair of basic residues;Direct protein sequencing;Disulfide bond;Protease inhibitor;Repeat;Secreted;Serine protease inhibitor;Signal |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..19; /evidence=ECO:0000269|PubMed:9475173 |
| Structure 3D | NMR spectroscopy (3); X-ray crystallography (4) |
| Cross Reference PDB | 1KGM; 1KIO; 1KJ0; 2F91; 2XTT; 3TVJ; 4DJZ; |
| Mapped Pubmed ID | 11856311; 15922357; 16475800; 21097875; 22511776; |
| Motif | |
| Gene Encoded By | |
| Mass | 9,842 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |