| IED ID | IndEnz0002008243 |
| Enzyme Type ID | protease008243 |
| Protein Name |
Serine protease inhibitor 3 Protease inhibitor SGPI-3 Serine protease inhibitor III |
| Gene Name | |
| Organism | Schistocerca gregaria (Desert locust) (Gryllus gregarius) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Protostomia Ecdysozoa Panarthropoda Arthropoda Mandibulata Pancrustacea Hexapoda Insecta Dicondylia Pterygota (winged insects) Neoptera Polyneoptera Orthoptera Caelifera (grasshoppers and locusts) Acrididea Acridomorpha Acridoidea Acrididae (short-horned grasshoppers) Cyrtacanthacridinae (migratory bird locusts) Schistocerca Schistocerca gregaria (Desert locust) (Gryllus gregarius) |
| Enzyme Sequence | MAKLLAVFLVLLIAALVCEQALACTPGSRKYDGCNWCTCSSGGAWICTLKYCPPSSGGGLTFA |
| Enzyme Length | 63 |
| Uniprot Accession Number | O46163 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: In vitro, active against alpha-chymotrypsin. {ECO:0000269|PubMed:9475173}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Disulfide bond (3); Domain (1); Peptide (1); Signal peptide (1); Site (1) |
| Keywords | Direct protein sequencing;Disulfide bond;Protease inhibitor;Repeat;Secreted;Serine protease inhibitor;Signal |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..23; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 6,533 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |