| IED ID |
IndEnz0002008263 |
| Enzyme Type ID |
protease008263 |
| Protein Name |
Anti-sigma-W factor RsiW
|
| Gene Name |
rsiW GK0151 |
| Organism |
Geobacillus kaustophilus (strain HTA426) |
| Taxonomic Lineage |
cellular organisms
Bacteria
Terrabacteria group
Firmicutes
Bacilli
Bacillales
Bacillaceae
Geobacillus
Geobacillus thermoleovorans group
Geobacillus kaustophilus
Geobacillus kaustophilus (strain HTA426)
|
| Enzyme Sequence |
MECPKEIVLLMHSYFDGDLQPEGEQQLKEHLRSCAACAAHFHELKKTVAFLQYAAHVAAPPSFAAKVMEAMPKERKTARLRRFLHRHPLLTAASLFLALTLGSLASSWGERGAFSVSADEHVIIRDHTVIVPKGETVKGDIVVRNGSIRIEGTVDGDVTVIHGKKYMASAGQVTGEVEEINQVFEWIWYNIKERFNRALQSIE |
| Enzyme Length |
203 |
| Uniprot Accession Number |
Q5L3P4 |
| Absorption |
|
| Active Site |
|
| Activity Regulation |
|
| Binding Site |
|
| Calcium Binding |
|
| catalytic Activity |
|
| DNA Binding |
|
| EC Number |
|
| Enzyme Function |
FUNCTION: Is the anti-sigma factor for SigW. The presence of RsiW leads to the inactivation of SigW, and its proteolytic destruction to sigma-W activation (By similarity). {ECO:0000250}. |
| Temperature Dependency |
|
| PH Dependency |
|
| Pathway |
|
| nucleotide Binding |
|
| Features |
Chain (1); Metal binding (3); Topological domain (2); Transmembrane (1) |
| Keywords |
Membrane;Metal-binding;Reference proteome;Transmembrane;Transmembrane helix;Zinc |
| Interact With |
|
| Induction |
|
| Subcellular Location |
SUBCELLULAR LOCATION: Membrane; Single-pass membrane protein. Note=Site-2 clipped RsiW is released from the membrane to the cytoplasm. {ECO:0000250}. |
| Modified Residue |
|
| Post Translational Modification |
PTM: Is processed by three successive proteolytic events. First, the extracellular region of RsiW is cleaved by PrsW (Site-1 cleavage) in response to cell envelope stresses. Next, it undergoes cleavage at an intramembrane site (Site-2 cleavage) mediated by RasP. This cleavage uncovers a cryptic proteolytic tag with conserved alanine residues in the transmembrane segment, that is recognized mainly by the ClpXP protease, which completely degrades the protein in the cytoplasm and leads to the induction of the sigma-W-controlled genes (By similarity). {ECO:0000250}. |
| Signal Peptide |
|
| Structure 3D |
|
| Cross Reference PDB |
- |
| Mapped Pubmed ID |
- |
| Motif |
|
| Gene Encoded By |
|
| Mass |
22,693 |
| Kinetics |
|
| Metal Binding |
METAL 30; /note=Zinc; via tele nitrogen; /evidence=ECO:0000250; METAL 34; /note=Zinc; /evidence=ECO:0000250; METAL 37; /note=Zinc; /evidence=ECO:0000250 |
| Rhea ID |
|
| Cross Reference Brenda |
|